Conserved Protein Domain Family
NPIP

?
pfam06409: NPIP (this model, PSSM-Id:310774 is obsolete and has been replaced by 399422)
Nuclear pore complex interacting protein (NPIP)
This family consists of a series of primate specific nuclear pore complex interacting protein (NPIP) sequences. The function of this family is unknown but is well conserved from African apes to humans.
Statistics
?
PSSM-Id: 310774
View PSSM: pfam06409
Aligned: 2 rows
Threshold Bit Score: 403.665
Threshold Setting Gi: 550540850
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
F8WFD2        22 VINTLADHRHRGTDFGGSPWLLIITVFLRSYKFAISLCTSYLCVSFLKTIFPSQNGHDGSTDVQQRARRSNRRRQEGIKI 101 human
XP_011715711   2 VINSLPDHFQPGPDFFGIPWIAIIIVFLGISTLGIFLWKTSFGVSFLKTVLKLQNVHDRSTDVQRRAWRSNSRSQEGIKI 81  pig-tailed macaque
F8WFD2       102 VLEDIFTLWRQVETKVRAKIckMKVTTKVNRHDKINGKRKTAKEhlrKLSMKEREHGEKERQVSEAEENGKLDMKEIHTY 181 human
XP_011715711  82 GLEDLFTSWRYMEAKVRAEV--HKVTTKVNSHYQIHGQRKTTEEg--KLRMKECEQAEKERQLSDAEENGKLVMKKIRTY 157 pig-tailed macaque
F8WFD2       182 MEMFQRAQALRRRAEDYYRCKITPSARKPLCNRVRMAAAE 221 human
XP_011715711 158 KKMFQDMQQLQWRTEDSYRCKITPYTRKALDNWVCAQALQ 197 pig-tailed macaque
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap