Conserved Protein Domain Family
Elongin_A

?
pfam06881: Elongin_A (this model, PSSM-Id:311064 is obsolete and has been replaced by 399694)
RNA polymerase II transcription factor SIII (Elongin) subunit A
This family represents a conserved region within RNA polymerase II transcription factor SIII (Elongin) subunit A. In mammals, the Elongin complex activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin is a heterotrimer composed of A, B, and C subunits of 110, 18, and 15 kilodaltons, respectively. Subunit A has been shown to function as the transcriptionally active component of Elongin.
Statistics
?
PSSM-Id: 311064
View PSSM: pfam06881
Aligned: 117 rows
Threshold Bit Score: 77.97
Threshold Setting Gi: 470249967
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7QA90       450 IGATGGIPFYILKPVLERANPTQLLHLEHFNP--HF--VEDSDVLWEQHCKRTFRSKQRnEEELE--------------T 511 Anopheles gambi...
XP_002443929 111 IESVDGIEMDLLKRILPHCTLEHLTKIEENTKm-DL--SSVTDPLWKRFYFREFGEEHT-NKVIArlkslketrsdtkyT 186 sorghum
XP_008661731  74 mGSVDGVEMDLLKRILPHCTMEQLTRVENSTEm-DL--SLVTDPLWRRFYQREFGQEHT-SKVIArlkelg---qktpyT 146 Zea mays
XP_004972743  25 VGHVDGIETELLKRILPHCTLEQLTRIENRTQm-DL--SPITDPLWRRFYQKEFGEDHT-NLVIKrmkeak---gkaryT 97  foxtail millet
XP_015650010  26 VDNVDGVEMDLLQRILPHCKMEDLTRIENNTEm-DL--TPVTDKLWKLFYTRQFGEENA-NQVVKrmsms-----garyK 96  Japanese rice
EMS51051      25 LNSVDIVPDELLKRILPHCTLEQLRHIESCTHa-DL--TDVTDVLWKRFFQREFGEENM-NLAIKrmken-----gvryK 95  Triticum urartu
XP_001774521  20 ISDVGETDIQLLKRILPHCNAEQLNHIESSTKgrDL--SPITDDLWRKCYGRKFGNDAV-EMVKErmsdr-----kckfK 91  Physcomitrella ...
XP_003573427  25 VSSMDGVEMQLLKRILPHCTLDQLTRIESCTEm-DI--SPATDVLWKTFYQRQFGEDHT-NNVVKkmkqs-----gvnyQ 95  Brachypodium di...
XP_002968045  23 fGDVGDTDLDLLRIILPHCTTDQLRHIENCSKdrDL--APVTNELWKKCYGRDFGPHSL-ELVESklkha----sksqfK 95  Selaginella moe...
EPT04083      30 IFTVSGMCYDLVKPILENCSAETLLRLEQTNP--VLswLMAVAEIWKGLCLRTSMKAAElCTSDQgpe---------peS 98  Fomitopsis pini...
Q7QA90       512 WREMFLRCSEERDAKLRSLTQNIKLSQEQAAAPIRKTQL 550 Anopheles gambiae str. PEST
XP_002443929 187 WWKLFEARQKKQKQAEDEMVEKFTKKFQAEKAEKQSKQI 225 sorghum
XP_008661731 147 WRELFAAKKEKQKEVEDKMLDKFTKKFQAERAEKQSKQI 185 Zea mays
XP_004972743  98 WKELFKAKTERQKEVEDRMLEKITKKFQAEKAEKQSKQI 136 foxtail millet
XP_015650010  97 WKDLFDAKTKKQKEYEEKMGQRLAKKYEAAKAEKQSKQI 135 Japanese rice
EMS51051      96 WKKLFEARTEKQKQVEARMSAGLKNKYQAANAGsgsssl 134 Triticum urartu
XP_001774521  92 WRQLYQAKCREQDEIQRKGVSRLRELYKEQNSQKERKQI 130 Physcomitrella patens
XP_003573427  96 WKDLFNAKTEKQKELEEIMIQRLAKKYQAEKAEKQSKQI 134 Brachypodium distachyon
XP_002968045  96 WRDLYEAKLKHREEKQQKGVELLQRLHMEEESKKQSRQl 134 Selaginella moellendorffii
EPT04083      99 WRDQYFALQEMEAQRFEELKSRLRTIRQEADDRKKGSQI 137 Fomitopsis pinicola FP-58527 SS1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap