1JV2


Conserved Protein Domain Family
Integrin_alpha2

?
pfam08441: Integrin_alpha2 (this model, PSSM-Id:312071 is obsolete and has been replaced by 400650)
Click on image for an interactive view with Cn3D
Integrin alpha
This domain is found in integrin alpha and integrin alpha precursors to the C terminus of a number of pfam01839 repeats and to the N-terminus of the pfam00357 cytoplasmic region. This region is composed of three immunoglobulin-like domains.
Statistics
?
PSSM-Id: 312071
View PSSM: pfam08441
Aligned: 38 rows
Threshold Bit Score: 348.535
Threshold Setting Gi: 156406056
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JV2_A        437 ARPVITV-NAGLEVyPSIl-NQDNKT--CSLPg--tALKVSC-FNVRFCLKADGKGVl------PRKLNFQVELLLDKL- 502  human
Q03600        495 SRPVISI-ETKHKMeKRMv-DIDKGVn-CPRG------AKTC-FPLDMVIYVDEETKrgaelvdFSSDVFMCNLEAIPF- 563  Caenorhabditi...
Q7QF51        468 ARPIINIrTYEEQQaGEPg-SIDPTRvgCPSDp---TANVTC-FSFRACSAVDDASLsegdvsaDSSLQLRCTIQAET-- 540  Anopheles gam...
Q29JH5        370 ARPIINI-QTSYRSeELRniDPNQPG--CRADa---FSNLTC-FTFEACCSIEPYDDs------TKELSLMYSVEAETY- 435  Drosophila ps...
Q17KN9        418 ARPITNI-KTSVMIeELQ--NIDPTKhgCRADp---TANATC-FSFKACCSIEPYEEsghssssTQPLNLIYTIEAETY- 489  yellow fever ...
XP_001641047  483 SRPIIDI-NTDVNItPNPf-NSRNKT--CSKTfkgkLIQTVC-IDIEICLSYSERRNrt---hdKLSIDLNIEADVEYTr 554  starlet sea a...
CAG01993      443 ARPVINV-KKDIQLsTKEi-DLTKKN--CGNT--------FC-LEVKACFSYTANPRs-----ySPRLTVVYSLEADAEn 504  spotted green...
CAG08300      486 ARPVVHI-GSTLQVtPNNi-DRDKIKeqCDm-----SLPSCSnFAARACFSYTAHPEs-----fSPKLILDYTFEADIKr 553  spotted green...
CAG04405      379 ARPVVHL-TTEFRVePKIv-DPNS----CT----------AC-ITATLCISFTLSNGnk---dfKKDITVNYTVEADS-- 436  spotted green...
XP_007615455  426 ARPVINIlQRSLVArPPV---LDPSL--CTAT--------SC-VQVELCFAYNQSAGnp---nyRRNITLAYTLEAD--- 485  Chinese hamster
1JV2_A        503 -KQKGAIRRALFL-----------------YSRSPSHSKNMTISRGGLMQCEELIAYLRD--EseFRDKLTPITIFMEYR 562  human
Q03600        564 --RADTTARGFIE-----------------GSHSHNYSWPCGSNSHVQKRTYRQLIYL-PvqE--SKDWITPLKFRFTVS 621  Caenorhabditi...
Q7QF51        541 --FLNKFSRVYFGtgggpgadktpavpgaaATRTNILKRRFRLAVSGRPVCHDVTAYLKE--G--TRDIQNPIQFRISYT 614  Anopheles gam...
Q29JH5        436 -DHLKKFSRAFFDr---------------dNKRSNVISRVVKVRTDGRVACQMVTGYIKA--N--TRDIQTPISFRLKYT 495  Drosophila ps...
Q17KN9        490 -NNLKKFSRVYFGpd--------------tRNRSNTLRKHISVITDGRQECREEVVYIKD--N--TRDIQNPIRFRLNYT 550  yellow fever ...
XP_001641047  555 nSRTSKQSRVVFSt---------------sEGPALNKTLTDALPHKPRKACFLEEVFLRE--N--VEDVYPDITFRINYK 615  starlet sea a...
CAG01993      505 -RKKGLISRAVFIe---------------gATKSYNSRGTVVLNSQGMVECVNRQLAIQE--N--IKDKLSGIPIDVSVE 564  spotted green...
CAG08300      554 -KKARLPPRVDF---------------------LGVPRGRLELPGQKRKICTDIELRLLR--D--FKDWLHAIPISVTAS 607  spotted green...
CAG04405      437 --GRKRSPRVHF------------------QDNQDDTFTGSLSLSSSSSNCQTLKLIVLP--P--VMDKLKPVDFTLSVS 492  spotted green...
XP_007615455  486 --RDRRPPRLRF------------------ARSQSAVFHGFFSMPETH--CQTLELLLMD--N--VRDKLRPIVIAMNYS 539  Chinese hamster
1JV2_A        563 L--------------DYRTAADTTGLQ--PILNQfTPANISRQAHIL-LD------------------------------ 595  human
Q03600        622 Irnek-------kpvQPPQGSQLVDLKhyPVLNK-YGASYEFDVPFN-TL------------------------------ 662  Caenorhabditi...
Q7QF51        615 LdeeranggtgaggrRGRKERELPRLE--PILNR-TAAERTYTMPFQ-KD------------------------------ 660  Anopheles gam...
Q29JH5        496 Le------------ePPLADSALTRLN--PMLDQ-TQAHIDFEGTFQ-KD------------------------------ 529  Drosophila ps...
Q17KN9        551 Il------------dTTLPASALDTLD--PILDQ-TQADRTFEATFQ-KD------------------------------ 584  yellow fever ...
XP_001641047  616 Mhep--------svpPTAAPGTLSSLKdyAMLETkKGSFASAMLKFQ-RDcvkcepnlqisdksdscsrvpvhvsltgsv 686  starlet sea a...
CAG01993      565 Iqd----------tkRKRRQSSFSQLP--PVLDAnVNNMVRSMVPFR-KEg----------------------------- 602  spotted green...
CAG08300      608 L--------------GDSTQWTSERVT--PVLDLfQPKYTVSEINITnRG------------------------------ 641  spotted green...
CAG04405      493 Lse-----------pKPKSRQSLQNLDsfPILSHdQKLTEKTEINFQ-KE------------------------------ 530  spotted green...
XP_007615455  540 Lpl----------rmPDRLKLGMRPLDayPVLNQaQALENHTEVHFQ-KE------------------------------ 578  Chinese hamster
1JV2_A            --------------------------------------------------------------------------------      human
Q03600            --------------------------------------------------------------------------------      Caenorhabditi...
Q7QF51            --------------------------------------------------------------------------------      Anopheles gam...
Q29JH5            --------------------------------------------------------------------------------      Drosophila ps...
Q17KN9            --------------------------------------------------------------------------------      yellow fever ...
XP_001641047  687 lvlelfsstgtcqsnrkcscplelfsstgtcqsnrkcscplelfsssgtcqsnrkcscplelfsstgtcqsnrkcscple 766  starlet sea a...
CAG01993          --------------------------------------------------------------------------------      spotted green...
CAG08300          --------------------------------------------------------------------------------      spotted green...
CAG04405          --------------------------------------------------------------------------------      spotted green...
XP_007615455      --------------------------------------------------------------------------------      Chinese hamster
1JV2_A        596 ---------------------------------------------CGEDNvCKPKLEV-SVDSDQKK------------- 616  human
Q03600        663 ---------------------------------------------CGEDHtCQTDLSL-KAAFKDIPlt----------- 685  Caenorhabditi...
Q7QF51        661 ---------------------------------------------CGVDGlCQSALVI-QNATLVGLarsgga-----ag 689  Anopheles gam...
Q29JH5        530 ---------------------------------------------CGDDDlCESDLVI-RAEPNITAidn---------- 553  Drosophila ps...
Q17KN9        585 ---------------------------------------------CGHDGiCQSKIDV-KAKLSLEQqvdg--------- 609  yellow fever ...
XP_001641047  767 lfsssgtcqsnrkcscplelfsstgtcpsnrkcscplelfsstgtCQSNGkCSCPLELfSSTGTCQSngkcscpl--elf 844  starlet sea a...
CAG01993      603 ---------------------------------------------CGNDNiCQSNLAL-SYRYGYMAaddisfvplelen 636  spotted green...
CAG08300      642 ---------------------------------------------CGSDNiCQSNLSL-EYRFCSRQmensksvfrslsr 675  spotted green...
CAG04405      531 ---------------------------------------------CGADNkCSSNLQM-SAKFIDDSskpyp-------r 557  spotted green...
XP_007615455  579 ---------------------------------------------CGPDNkCDSSLQM-RAAFVSEQlq----------- 601  Chinese hamster
1JV2_A        617 ----IYIg-DD--NPLTLIVKAQN------QGEGAYEAELIVSI-PLQADFIGVVrn----------------nEA--LA 664  human
Q03600        686 --snGYVsnVGekDYLDLTFTVEN------KKEKAYQANFYLEYnEEELELPQVQ------------------------- 732  Caenorhabditi...
Q7QF51        690 geyqLVLg-LD--RTLTLALTVQN------RADSAYETHLYVRH-DASLTYAGSK------------------------G 735  Anopheles gam...
Q29JH5        554 -kytLIL--DE--TELEVGISVSN------LADSAYEAQLFISH-QAGVSYVATK-------------------KP--TN 600  Drosophila ps...
Q17KN9        610 -sysLVLg-RD--RGILLNVSVSN------QADSAYETHLYVKH-DPSISYSGTKvyseckrnrkpfiynnapfHF--QS 676  yellow fever ...
XP_001641047  845 ssyyITLavGE--RDYVVDVTISN------TGESAYNTELLVTI-PEGVAQSRVLdas--------------dtDK--EA 899  starlet sea a...
CAG01993      637 gipvIKLs-NQ--KNVALEVNVTNl-----NGDDAYEASMVAAF-LSSLTYSEFRvp----------------lNVslKH 691  spotted green...
CAG08300      676 kdgvAVItpTE--EDIALEMTVTNr-----GGDDAHQTRSIISL-PDTLHYSSVVt-----------------tAS--EP 728  spotted green...
CAG04405      558 qgnfQVLqyNSsvKVVRLLVEVTNvpsagrLAEDAHQAALNVTI-PDALRYSAVS------------------------K 612  spotted green...
XP_007615455  602 --plSRLqySRdtKKLFLSINVTNtpsrerAGEDAHEALLTLEV-PPALLLSSVR------------------------P 654  Chinese hamster
1JV2_A        665 RlSCAFKTENqt----rQVVCDLGNPMKA--GTQLLAGLRFSVHQQSE---------MDTSVKFDLQIQSSNLFDK---V 726  human
Q03600        733 ----GSKRMIaetigknIVHLPLGNPMNGasKHQFTIQFKLTRGRTEG---------IGKALKFMAHVNSTSQETEeelK 799  Caenorhabditi...
Q7QF51        736 SsVCGAHNAT-------MVDCSIGNPLKR--NGEVQLSLRFDARSLEEygsskgpngLSQHVALAVFVNTTSQDTG---N 803  Anopheles gam...
Q29JH5        601 A-TCNSFNTT-------LVVCSLGNPMLR--GTTTFVTIRFQPKSLEP---------NENSMLFHIFANTTSKLVGg--E 659  Drosophila ps...
Q17KN9        677 LhTCTQFNST-------LVDCSLGNPMRR--GTEAKLSLRFDPQRVDD---------LVSKLTFQVFVNTTSALLEgtkS 738  yellow fever ...
XP_001641047  900 FsIGHQAVSDktennstRLRIPIGNPMKT--RTMKRVQVFLNTGSFSK---------SQDFLPILLEVTSSNKEQPeqlK 968  starlet sea a...
CAG01993      692 PvSCTANKNGs------LVDCELGNPFKR--NSEAIFYIIMGTSGISL---------DTNEVEVELKFETTSEQQ----A 750  spotted green...
CAG08300      729 KvDCTANDKGt------LIDCELGNPIEK--DAEVTFYVMLTTSGISL---------STKAVNISLQLQTTSTQV----- 786  spotted green...
CAG04405      613 SvQCRFDG---------TLICDLGNPVKG--NEKISVRIKFETA-IDL---------NTRELEAQLMLSTLSEQT----D 667  spotted green...
XP_007615455  655 SgTCQANE---------TILCELGNPFKR--NQRMELLIAFEVIGVTL---------HTRDLKAQLQLSTSSHQD----N 710  Chinese hamster
1JV2_A        727 SPVvsHKVDLAVLAAVEIRGVSSPDHVFlp----ipNWEHKEnpeTEEDVGPVVQHIYELRNNGPS--SFSKAMLHLQWP 800  human
Q03600        800 DNKweAEVQIIKKAELEIYGISDPDRVFfg-----gKARAESeleLEEDIGTMVRHNYTIINHGPW--TVRNVEAHISWP 872  Caenorhabditi...
Q7QF51        804 RTRaqLNLRIQRAVKLSISGKALPEQVFyggggeqiMGESAIh--SLDEIGMPVQHKYQIYNDGPW--RAPMVRLEIDWP 879  Anopheles gam...
Q29JH5        660 PPErnLSVSVVRQAKLHFRGWAMPEQSFysg---asQVTDNSp-mEMVDVGSQVNHSFTIFNDGPS--TAPKVRMIIHWP 733  Drosophila ps...
Q17KN9        739 EAS--IVANVIKRAKISISGAAHPEQAFygg---dvKGESAMe--TVEDIGTAVQHIYLIYNDGPW--RAPKVQVNIQWP 809  yellow fever ...
XP_001641047  969 DNLieLNVTIVSQADLELSGSFKQEQVSygg---evKGESAMr--VEDEIGNEVRHTYIAQNKGPD--FVPEAEVVIQWP 1041 starlet sea a...
CAG01993      751 LMAvkAKAKVAILLQLSVSGQALPSQAYfsg---kvIGEEAIk--TESEMGSAITHRFKIINLGKS--LTEAAVLEIDWP 823  spotted green...
CAG08300      787 LKPveASAKVFFELKLQLYGVARPSQVSfgr---slEGKSTIn--SVEEIGALVQYEFRITNLGRSlkYFTNASLNIFWP 861  spotted green...
CAG04405      668 LMPvaVALMIENTIIPSFSIVHPLVQTKfgg---tvKGESAMv--NTSDIGSLVEFTFKVDITGQPlgELGTLAVEFDWP 742  spotted green...
XP_007615455  711 LQPmtLILQVDYTLQASLSLMTHRLQSFfgg---tvMGEAGMk--TEEDVGSPLKYEFQVSPVGDGlaALGTLVLGLEWP 785  Chinese hamster
1JV2_A        801 YKYNNNT--------LLYILHYd--------iDGPMN--CT----------------SDMEINPLRikissL-------- 838  human
Q03600        873 YQLRSRFgrg---knALYLLDVptitteftdgTSEVRk-CFik-------------qQYEYVNPAE-----Ik------- 923  Caenorhabditi...
Q7QF51        880 LQVANNKpqg---kwLLYLDALpvldmsgimgDGRST--CDvlrkdepdgavvaggdSVPLVNPLG-----L-------- 941  Anopheles gam...
Q29JH5        734 WSLYSDPerghmdlyLLYLEQMpt------veIGVGE--CHv---------------APEYVNPLK-----Lasgsqesa 785  Drosophila ps...
Q17KN9        810 HQVANDKpqg---kwLLYLTDTptv-----eaTNGGD--CVv--------------dPHSAINPLG-----Lkkssv--- 857  yellow fever ...
XP_001641047 1042 FEATNGKh-------LLYLMDVe--------iSGNAE--CTf---------------APDQPNLLG-----Livkpks-- 1082 starlet sea a...
CAG01993      824 KETADEKw-------LLYLMNIsl------sgVKQIN--CS----------------PKGEINPRQ-----K-------- 859  spotted green...
CAG08300      862 KENSLGKw-------LLYLTQTsn------tgVQSVP--CS----------------PVKEINPLK-----N-------- 897  spotted green...
CAG04405      743 FEVPNGKw-------LLYLTKIvv------sgQSKME--CN----------------PPDVVNPLN-----L-------- 778  spotted green...
XP_007615455  786 YEVSNGKw-------LLYPTEIt--------iHSNGSwpCQp---------------PGNLVNPLN-----L-------- 822  Chinese hamster
1JV2_A        839 --------------QTTEKNDTVAGQGERDHLITKRDLALSEGdihtl-------------------------------- 872  human
Q03600        924 --------------LNTKYSTQETAPHRVEHRMKREIDEDEEEqsddlgaveenipwfstanfwnlfaikggdgrprevk 989  Caenorhabditi...
Q7QF51        942 ------------------PSRTGPSAPPSPFTALRSANYTRAGrvrrdramvlrpqa------------------gdgav 985  Anopheles gam...
Q29JH5        786 sgflgapatlmmvhGRSQLNKNQTHSTHSTHSRQQRSTLERVTrlerliyepeaagmgssg-----------sgkkqdiv 854  Drosophila ps...
Q17KN9        858 ----------lgqlMQMERYTQRAYNKSLTFTSEKSERISFAKqtssasentlnrvrrdrsmiiraerltdkdgkqtdiv 927  yellow fever ...
XP_001641047 1083 --------sparnvTSRQSSSESTRTTRVRRAVEEETSIKTKRatadergssv--------------------------- 1127 starlet sea a...
CAG01993      860 -----------------APRS-RRAAKNSLEGDKGTISRYTDEkksqtl------------------------------- 890  spotted green...
CAG08300      898 --------------V-KGLSRKKREAELEALTSGDFSFLPTKRkyktlt------------------------------- 931  spotted green...
CAG04405      779 ----------------SLSEPSRRRTKRQVLVDDGDTVQQQIGnpqaaitlvtspr---------------------ksf 821  spotted green...
XP_007615455  823 --------------ILSEPGDKPHSPQRRRRQLDPGGDQGSPPvtlaaakkaks------------------------et 864  Chinese hamster
1JV2_A        873 ----gcgvaQCLKIVC 884  human
Q03600        990 hlscqdntaNCFTVIC 1005 Caenorhabditis elegans
Q7QF51        986 qmdcasqtaKCVRIVC 1001 Anopheles gambiae str. PEST
Q29JH5        855 eldcnkgtaRCIRIEC 870  Drosophila pseudoobscura
Q17KN9        928 hmdckrntaKCISIVC 943  yellow fever mosquito
XP_001641047 1128 kldcetgtaRCTPIRC 1143 starlet sea anemone
CAG01993      891 ---scdqgaKCVKIKC 903  spotted green pufferfish
CAG08300      932 ----cadglRCVEICC 943  spotted green pufferfish
CAG04405      822 lmecskgtaRCVSFTC 837  spotted green pufferfish
XP_007615455  865 vltcasgraRCVWLEC 880  Chinese hamster
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap