3K65


Conserved Protein Domain Family
Thrombin_light

?
pfam09396: Thrombin_light 
Click on image for an interactive view with Cn3D
Thrombin light chain
Thrombin is an enzyme that cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII. Prothrombin is activated on the surface of a phospholipid membrane where factor Xa removes the activation peptide and cleaves the remaining part into light and heavy chains. This domain corresponds to the light chain of thrombin.
Statistics
?
PSSM-Id: 312783
View PSSM: pfam09396
Aligned: 26 rows
Threshold Bit Score: 71.9483
Threshold Setting Gi: 0
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3K65_B          3 TSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYIDGR 49  human
1_pfamImport    2 LDQRKAFFNPRSFGNGELDCGERPLFEKINKADKNEKELLMSYTGSR 48 
19_pfamImport   1 -QARKNLFSPRTFGQGEDDCGQRPLFEKISKTDQKEAELLESYAGAR 46 
16_pfamImport   1 --AKKLFFNPRTFGEGESSCGLRPLFELKSKKDAKEQELLDSYREQR 45 
10_pfamImport   1 --ARKTFFSPRTFGEGESVCGERPLFEKLKKKDRNEAELLESYRQER 45 
21_pfamImport   1 --EKKLFFSPRSFGQGESVCGQRPLFEQKGKQDKNENELLESYREQR 45 
XP_005986997  306 TGEHKLFFNPKYFGQGENGCGLRPLFEEKNIEDNGEKELLESYIGGR 352 coelacanth
CAF95775      290 LSSRKQFFNPRTFGQGENDCGQRPLFEKISKKDAKEDELLESYREKR 336 spotted green pufferfish
XP_003214643  311 TVEHQILFNPSTFGDGEADCGVRPLFEKKKISDNSEQELLDSYQGGR 357 green anole
NP_001027864  311 SSSKKRFFNPRTFGEGEDECGRRPLFEQKNKKDASEDELLQSYREKR 357 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap