Conserved Protein Domain Family
RAG1

?
pfam12940: RAG1 
Recombination-activation protein 1 (RAG1), recombinase
This family is one of the two different components of the RAG1-RAG2 V(D)J recombinase complex. The RAG complex, consisting of two RAG1 and two RAG2 proteins is a multi-protein complex that mediates DNA cleavage during V(D)J (variable-diversity-joining) recombination. RAG1 mediates DNA-binding to the conserved recombination signal sequences (RSS). Many of the proteins in this family are fragments. Solution of the structure of the complex of RAG1 and RAG2 shows that each protein dimerizes with itself and each pair then complexes together to from the RAG1-RAG2 V(D)J recombinase enzyme. The different structural elements in RAG1 for UniProtKB:P15919 are: an N-terminal nonamer-binding domain from residues 391-459; a dimerization and DNA-binding domain from 459-515; an extended pre-RNase H domain from 515-588; the catalytic RNase H domain from 588-719; a ZnC2 domain from 719-791; and ZnH2 domain from 791-962; and a three-helix C-terminal domain from 962-1008.
Statistics
?
PSSM-Id: 315595
Aligned: 2 rows
Threshold Bit Score: 1392.08
Threshold Setting Gi: 1110954617
Created: 21-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_019217497  405 DNFLLTNKGGRPRQHLLSLTRRAQKHRLRDLKSQVKVFADKEEGGDLKSVCLTLFLLALRSGNEHRQADELEAMMQGRGF 484  Nile tilapia
XP_006642506  388 DNYLPVNKGGRPRQHLLSLTRRAQKHRLRGLKHQVKVFAEKEEGGDIKSVCLTLFLLALRAGNEHRQADELEAMMQGRGY 467  spotted gar
XP_019217497  485 GLSPAVCLAIRVNTFLSCSQYHKMYRTVKATSGRQIFQPLHTLRAAEKELLPGFHQFEWQPALKNVSPSCNVGIINGLSG 564  Nile tilapia
XP_006642506  468 GLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSGRQIFQPLHTLRNAEKALLPGYHHFEWQPALKNVSTSTDVGIIDGLSG 547  spotted gar
XP_019217497  565 WSSSVDDVPADTITRRFRYDVALVSALKDLEEDIMEGLRESGMEDSAcTSGFSVMIKECCDGMGDVSEKHGGGPVVPEKA 644  Nile tilapia
XP_006642506  548 WTPSVDDQQMDTITRRFRYDVALVAALKDLEEDILEGMKEQGLDDSS-TEGFTVVVKESCDGMGDVSEKHGSGPAVPEKA 626  spotted gar
XP_019217497  645 VRFSFTVMsvSVLADDEE-EEVAIFTEPKPNSELSCKPLCLMFVDESDHETLTGVLAPIVAERNAMKESRLILSMGGLPR 723  Nile tilapia
XP_006642506  627 VRFSFTIM--SILARNEEgENVKVFHELKPNSELCCKPLCLMFADESDHETLTAILGPVMAEREDMKESRLILSIGGLLR 704  spotted gar
XP_019217497  724 SFRFHFRGTGYDEKMVREMEGLEASGSTYICTLCDSSRAEASQNMVLHSITRSHEENLERYEIWRTNPFSESVDELRDRV 803  Nile tilapia
XP_006642506  705 SFRFIFRGTGYDEKLVRDVEGLEASGSTYICTLCDSTRAEASKNKVLHAITRSHEENLERYEIWRTNPYSESADDLRDRV 784  spotted gar
XP_019217497  804 KGVSAKPFLETQPTLDALHCDIGNATEFYKIFQDEIGEVYKKANPSREERRSWRAALDKQLRKKMKLKPVMRMNGNYARR 883  Nile tilapia
XP_006642506  785 KGISAKPFMETQACIDALHCDIGNATEFYKIFQDEIGEVHLNSSPTKEERKRWQSALDKQLRKKMNLKPVMRMNGNFSRK 864  spotted gar
XP_019217497  884 LMTQEAVDVVCELVPSEERREALRELMKLYLQMKPVWRATCPAKECPDQLCRYSFNSQRFADLLSTTFKYRYNGKITNYL 963  Nile tilapia
XP_006642506  865 LMTRETVEAVCELVPSKERQEALRELMHLYLQMKPVWRSTCPAKECPDLLCRYSFNSQRFAELLSTTFKYRYDGKITNYL 944  spotted gar
XP_019217497  964 HKTLAHVPEIIERDGSIGAWASEGNESANKLFRRFRKMNARQSKTFELEDVLKHHWLYTSKYLQKFMEAHKDSAKALQAT 1043 Nile tilapia
XP_006642506  945 HKTLAHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKSYELEDILKHHWLYTSKYLQKFMEAHKNSAKALEAT 1024 spotted gar
XP_019217497 1044 IDPVEIQDDD-EM 1055 Nile tilapia
XP_006642506 1025 INPVETQDEDiDV 1037 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap