Conserved Protein Domain Family
RING-HC_TRIM9_like_C-I

?
cd16576: RING-HC_TRIM9_like_C-I (this model, PSSM-Id:319490 is obsolete and has been replaced by 438238)
RING finger, HC subclass, found in tripartite motif-containing proteins TRIM9, TRIM36, TRIM46, TRIM67, and similar proteins
Tripartite motif-containing proteins TRIM9, TRIM36, TRIM46, and TRIM67 belong to the C-I subclass of TRIM (tripartite motif) family of proteins that are defined by their N-terminal RBCC (RING, Bbox, and coiled coil) domains, consisting of three consecutive zinc-binding domains, a C3HC4-type RING-HC finger, Bbox1 and Bbox2, and a coiled coil region, as well as a COS (carboxyl-terminal subgroup one signature) box, a fibronectin type III (FN3) domain, and a B30.2/SPRY (SplA and ryanodine receptor) domain positioned C-terminal to the RBCC domain. TRIM9 (the human ortholog of rat Spring), also known as RING finger protein 91 (RNF91), is a brain-specific E3 ubiquitin-protein ligase collaborating with an E2 ubiquitin conjugating enzyme UBCH5b. TRIM9 plays an important role in the regulation of neuronal functions and participates in the neurodegenerative disorders through its ligase activity. TRIM36 (the human ortholog of mouse Haprin), also known as RING finger protein 98 (RNF98), or zinc-binding protein Rbcc728, is an E3 ubiquitin-protein ligase expressed in the germ plasm. It has been implicated in acrosome reaction, fertilization, and embryogenesis, as well as in the carcinogenesis. TRIM46, also known as gene Y protein (GeneY) or tripartite, fibronectin type-III and C-terminal SPRY motif protein (TRIFIC), is a microtubule-associated protein that forms parallel microtubule bundles in the proximal axon and plays a crucial role for the establishment and maintenance of neuronal polarity. TRIM67, also known as TRIM9-like protein (TNL), is a protein selectively expressed in the cerebellum. It interacts with PRG-1, an important molecule in the control of hippocampal excitability dependent on presynaptic LPA2 receptor signaling, and 80K-H, also known as glucosidase II beta, a protein kinase C substrate.
Statistics
?
PSSM-Id: 319490
Aligned: 10 rows
Threshold Bit Score: 58.1652
Created: 1-May-2015
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Zn binding siteRING-HC finger
Feature 1:Zn binding site [ion binding site]
Evidence:
  • Comment:Based on the structural evidence that Mus musculus Hakai (3VK6) binds two Zn2+ ions through its RING-HC finger.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #  #           # #  #  #                                                   
Q9NQ86        28 ERELICPACKELFthPLILPCQHSICHKCVKELLltlddsfndvgsdnsnqssprlrlps-------------------- 87  human
CCD58498      44 DSELRCPSCRRFFqcPLLLPCGHSLCNLCAAGALlpasepsiaasiaaalqlttaetfspasgppqsssssssttgssig 123 Schistosoma man...
NP_723600      2 EDELRCPTCKQLYanPVLLPCFHALCLGCALDIQtpyspgsalpgavngagaasaaghnglhgngggagggaaapvtnpn 81  fruit fly
Q6ZTA4         2 EEELKCPVCGSLFrePIILPCSHNVCLPCARTIAvqtpdgeqhlpqplllsrgsglqagaaaaaslehdaaagpacggag 81  human
Q9C026         5 EEELKCPVCGSFYrePIILPCSHNLCQACARNILvqtpesespqshraagsgvsdydyldldkmslyseadsgygsyg-- 82  human
EEN46914       2 EEELKCPVCRCFFnvPIILPCQHSICLSCAASQVtqtyglkpteedalsyrhstisspgsdyssaydytdldkfdkl--- 78  Florida lancelet
Q7Z4K8        28 EKELLCPVCQEMYkqPLVLPCTHNVCQACAREVLgqqgyighggdpsseptspastpstrsprlsrr------------- 94  human
EFX77634       2 EDELKCPSCRQFFtqPVLLPCFHAMCLNCALHNQqptdsgvvvstsgssggssrpsschihpa----------------- 64  common water flea
EDO41245       2 EEELQCPVCNKPYncPVVLPCSHSICMSCTKAITttsgadyqvssgekepvadpfsd----------------------- 58  starlet sea ane...
XP_003723611   2 EEELRCTACRGFYtnPVILPCTHNICFPCVLSLQqvngtavlpasndqpqqstnstgtqydfsfdfpeadrlsafsd--- 78  purple urchin
Feature 1                                                                                        
Q9NQ86        88 -------------------------------------------------------psmdkidrinrpgwkrnsltprttv 112 human
CCD58498     124 cpstsnsqgntqtmgctsiipsdsdqmsvvsetdsgvivssrpgsyvgrlpvvicsstsglgpsqtysissssislvssg 203 Schistosoma man...
NP_723600     82 gpgtrhsshssaasta--ssntgsesvtsdqdqsdkvsifseadsgvvccsntsrpvsyagtgllpgvgnvvappgaayc 159 fruit fly
Q6ZTA4        82 gsaagglgggagggg-----dhadklslysetdsgygsytpslkspngvrvlpmvpappgssaaaargaacsslssssss 156 human
Q9C026        83 -------------------------------------gfasapttpcqkspngvrvfppampppathlspalapvprnsc 125 human
EEN46914      79 --------------------------------------slyseadsgygaslsgyaatcpsspafstvsasssistttsc 120 Florida lancelet
Q7Z4K8        95 -----------------------------------------------tlpkpdrldrllksgfgtypgrkrgalhpqvim 127 human
EFX77634      65 ---------------------------------------------------ssssssstttttttnssnsnalvvaatis 93  common water flea
EDO41245      59 ----------------------------------------------------------dsgyvsvyevnhlyqaignfpc 80  starlet sea ane...
XP_003723611  79 -------------------------------------gdsgvsfvggyapsqasgsssssgassgigkngfttanpetlr 121 purple urchin
Feature 1          #  #  
Q9NQ86       113 FPCPGCEH 120 human
CCD58498     204 LICPICNH 211 Schistosoma mansoni
NP_723600    160 LTCPLCRK 167 fruit fly
Q6ZTA4       157 ITCPQCHR 164 human
Q9C026       126 ITCPQCHR 133 human
EEN46914     121 IRCPQCRR 128 Florida lancelet
Q7Z4K8       128 FPCPACQG 135 human
EFX77634      94 LSCPSCRK 101 common water flea
EDO41245      81 LKCPICRK 88  starlet sea anemone
XP_003723611 122 ISCPQCHR 129 purple urchin

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap