Conserved Protein Domain Family
7tmF_FZD5_FZD8-like

?
cd15035: 7tmF_FZD5_FZD8-like 
class F frizzled subfamilies 5, 8 and related proteins; member of 7-transmembrane G protein-coupled receptors
This group includes subfamilies 5 and 8 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of GPCRs, as well as their closely related proteins. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.
Statistics
?
PSSM-Id: 320163
View PSSM: cd15035
Aligned: 21 rows
Threshold Bit Score: 442.872
Threshold Setting Gi: 321476679
Created: 14-Nov-2013
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
  next features
Feature 1:putative ligand binding site [chemical binding site]
Evidence:
  • Comment:based on sequence similarity to Human smoothened receptor bound to an antitumor agent.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      #        #                                                 #                   
P58421    212 PYFTQDEKMFVTFWIGLWSILCFISTFTTVATFLIDMERFRYPERPIIFLSACYLFVSIGYVVRLIVg-HENVACN---- 286 African clawed frog
CDJ13038  298 HFQTETDKKFVDFWLWLWSALCAVSTIITMLTFLTDPSRFQYPGQPIIYLSTCYFFVSVGYILRMAVg-HENVACTavqa 376 Rodentolepis micro...
EFX87639  278 PFFSEDEQWFASLWIALWAAIAALSSALTFATFLIDRPRFRYPERPLIFLSACYVGLSLGYLVRIVVggRDVVACE---- 353 common water flea
Q9VVX3    307 PFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLq-NEEIACD---- 381 fruit fly
EFV59051  226 LFMSSENHHFVTFWIGLWAVLCFMSTLVTVLTFLIDMHRFHYPERPIIFLSFCYLMVSGGYLIRLVVg-HDPVACD---- 300 Trichinella spiralis
CCD58691  138 TFSNQSDKTFATFWLGLWAVLCILSTLATVTTFLADPSRFQYPERPIIYLSACYFMIALGYLIRVGMg-HEAIACD---- 212 Schistosoma mansoni
CCD58624  236 YYPINSSYHFTTFWLGIWSIFCAISTLITIFTFIIDSYRFQYPELPLIYLSLCYFMISMGYLIRVFMg-HQAIACDslpn 314 Schistosoma mansoni
CBY20718  212 PFLTQDERRFLDSWVLSGAVIVAIATVIVLGTFCLDPQRFSYPERPILYLSLCYLFIAAGYILRYSVg-SDSISCD---- 286 Oikopleura dioica
AFI99118  240 FYFKEDEANFVTFWLGLWSIIAFIGTLITIATFFIDRSRFTQAERPIVFMSFCYFLVAFGYIVRLIYg-HDAIACDs--- 315 Clytia hemisphaerica
ACC54556  223 YFFSNTQNIFMKFWLSLWSILSLITTAVTLLTFLIDRTKFKFVEQPIILISFCYFIVSFGYIIRLIYg-FKAIACNd--- 298 green hydra
Feature 1                                                                                     
P58421        -------------------------------------------------------------------------------- African clawed frog
CDJ13038  377 llkse------------------------------------------------------------------envqkrivs 390 Rodentolepis micro...
EFX87639      -------------------------------------------------------------------------------- common water flea
Q9VVX3        -------------------------------------------------------------------------------- fruit fly
EFV59051      -------------------------------------------------------------------------------- Trichinella spiralis
CCD58691      -------------------------------------------------------------------------------- Schistosoma mansoni
CCD58624  315 qyenlqndltqttmnnnhnhdwfgynptnihenlksvtiypdtitttttvakatmttnelsmitskttsnllkspnqlir 394 Schistosoma mansoni
CBY20718      -------------------------------------------------------------------------------- Oikopleura dioica
AFI99118  316 -------------------------------------------------------------------------------k 316 Clytia hemisphaerica
ACC54556  299 -------------------------------------------------------------------------------h 299 green hydra
Feature 1     #                                                                               
P58421    287 KDHIHYETt-------------------GPALCTIVFLLIYFFGMASSIWWVILTFTWFLAAGMKWGnEAIASYSQYFHM 347 African clawed frog
CDJ13038  391 ASILQYSLv-------------------GKAVCATVFIFTYYFGMASSVWWVLLTVTWFLAAGLKWSnEAISKYTQVFHF 451 Rodentolepis micro...
EFX87639  354 GNAIRYGAapslittgtgasfigvssstSSPACVVTFLLVYFFGQAAGLWWVILSLTWFLAAGRKWGsEAIARCSPYFHL 433 common water flea
Q9VVX3    382 GLLLRESSt-------------------GPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGnEAITKHSQYFHL 442 fruit fly
EFV59051  301 GSAIRTGSsg----------------sgPAAVCTVVFLLTYFFSMASSVWWVVLSLTWFLAAGLKWSnEAISGYSPYFHM 364 Trichinella spiralis
CCD58691  213 GPILRISTt-------------------GPAQCSVVFLLTYVFGMASSVWWVILTLTWFLAAGLKWGtEAIAKYSQIYHF 273 Schistosoma mansoni
CCD58624  395 SKILRYALn-------------------GRASCAVVFLLIYFFNMAASIWWVILALTWLLAAGLKWGsEAISKYSQVFHF 455 Schistosoma mansoni
CBY20718  287 AAHPERLAlp----------------grGTAYCNLVFVLTYYFGMASSIWWVMLTFAWFLAAGMKWScEAISNYSSYMHA 350 Oikopleura dioica
AFI99118  317 TGLARYAAt-------------------GPAHCTTVFFMTYFFANVAWIWWVVLSMNWFLSSGLRWPsKAISSYSQYFHF 377 Clytia hemisphaerica
ACC54556  300 TGFLHYASt-------------------GPASCTAVFILTYFFTNVSWIWWVVLSINWFLSSGLKWTnGTISSYSQYFHF 360 green hydra
Feature 1                          #    # #  ##    #                                          
P58421    348 AAWLIPSVKSIAVLALSsVDGDPVAGICYVGNQNLDNLRGFVLAPLVVYLFSGTMFLLAGFVSLFRIRSVIKqg------ 421 African clawed frog
CDJ13038  452 VAWVLPGVQTGVILMLRaVDGDPVSGLCYVGSTNDNHLIYFLILPLVIYFCFGTFFLLGGFVALCNIRRVIKfq------ 525 Rodentolepis micro...
EFX87639  434 VAWTIPAVQTAAALLMAaVDGDSLAGVCHVGVQQTALLRWLVLFPLGLHLLLGGGFLLAGLAGLARIRRVLKeq------ 507 common water flea
Q9VVX3    443 AAWLIPTVQSVAVLLLSaVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKqqgg---v 519 fruit fly
EFV59051  365 FAWALPSVKTVAILALSaVDGDPISGICSVGNTDVSWLRWFVLGPLFAYLVLGVFFLMAGFVSLVRIHHIVKqqq----- 439 Trichinella spiralis
CCD58691  274 FAWFLPGTKAIIILILSaIDGDPIGGLCTVGSIHLNYLRLFILIPMCIYLTLGTIFLLAGFVALFKIRNEIKlqt----- 348 Schistosoma mansoni
CCD58624  456 IAWSLPASQTALALLLSiVEGDPISGLCTIQSNKSIPFLLFTFIPLLIYLIIGILFMMIGFIALFHIRGTIKlqr----- 530 Schistosoma mansoni
CBY20718  351 VAWTIPALQTILIMVTNqVDGDPFLGICSVGNNNIEQMHTFILAPLVVYLSAGGLFLIVGFFSLFRIRNTMKkq------ 424 Oikopleura dioica
AFI99118  378 IAWIVPTVQTMAILAMSaIDGDPVSGLCSVGNHNNNNLTIFMIAPLLIYTMLSLSFFVAGVIAIVQRKRHNKsnngqitp 457 Clytia hemisphaerica
ACC54556  361 VAWLIPTIQTMAILAMSaIDGDPVSGLCTVGNHDSNTLTIFVIGPLLIYTMLSLSFFIAGVVAKLRIEQTIRne------ 434 green hydra
Feature 1                                             #  ##                                 # 
P58421    422 --gTKTDKLEKLMIRIGIFSVLYTVPATIVVACYIYEQHYREhWEKTHNCScpgd------------------kqrYRPD 481 African clawed frog
CDJ13038  526 -prVGTDKLEKLMIKLGIFGLLYTVPAIVVIACYIHELRWRRvWQLGVACQcdwrnekdg-------shldvdwspPTPE 597 Rodentolepis micro...
EFX87639  508 -grPKAEKLEKLMIRIGIFSVLYSVPAAILLGCYAYEVAFHVeWGRTLTCSgcpsspda----------tplpsyqSRPD 576 common water flea
Q9VVX3    520 gagVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEdWIKALACPcaqv-----------------kgpgKKPL 582 fruit fly
EFV59051  440 -glSKIEKLEKLMVRIGIFSVLYTIPATILIGCYFYEQHYRVlWEIGITCQgpdcala-----------tgrahqpTKPE 507 Trichinella spiralis
CCD58691  349 rghLKTDKLEKLMIRIGIFGVLYTVPATIVIACYCYELYNRDiWNKAHNCPsddgftlh---------inppiyanVQPE 419 Schistosoma mansoni
CCD58624  531 priIEIHKLDKLIIRIGIYGMLYTIPNLIVLFIIGYELRNTYiWQLGIACHchydigqyneevepilpvalpiwnpSKPE 610 Schistosoma mansoni
CBY20718  425 -qdRETKKLEKLIIKIAIFSVLYMIPASIQVFCYFYESEFREaWEKELNCHncg-------------------srfDETS 484 Oikopleura dioica
AFI99118  458 eyfDEERQACSYVSKIGVYTFMVFFPAFTLIGCYFYEHNNKEiWEKSTNCPcvr--------------------dkVRPN 517 Clytia hemisphaerica
ACC54556  435 --aKNNLKSGRFLSRVGMFTLILFVPAVSLLGCYFYEHSYKEiWEKSTNCDcmp--------------------ikKQPI 492 green hydra
Feature 1        #  ##                            
P58421    482 YAVFMLKYLMCLVVGITSGVWIWSGKTLESWKRFTG 517 African clawed frog
CDJ13038  598 YAIFMLKYFMSLIVGITSGFWIWSGKTVEAWKKICR 633 Rodentolepis microstoma
EFX87639  577 FSIFMLKYFMTLVVGITSGFWIWSHKTLDSWRKFYR 612 common water flea
Q9VVX3    583 YSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWR 618 fruit fly
EFV59051  508 FSIAVLKYFMCLVVGITSGIWIWSPKTLDSWKRFCL 543 Trichinella spiralis
CCD58691  420 YAIFMLKYFMSLVVGITSGFWIWSSKTVNSWQLCLK 455 Schistosoma mansoni
CCD58624  611 YSIYMLKHFMTLMIGIISGFWIWSNKTIDTWRRFCF 646 Schistosoma mansoni
CBY20718  485 YLIIFLKPAMSFLVGIAAATWICCDKTLRTWKRMCC 520 Oikopleura dioica
AFI99118  518 YYVYLLKYFMSLVIGLISGFWVLDSRTVDSWKRFLL 553 Clytia hemisphaerica
ACC54556  493 FYIFLFKYLMSLVIGIAIGLGTLNSDALGAWRRFFK 528 green hydra

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap