Conserved Protein Domain Family
7tmA_NPY5R

?
cd15398: 7tmA_NPY5R 
neuropeptide Y receptor type 5, member of the class A family of seven-transmembrane G protein-coupled receptors
NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. When NPY signals through NPY2R in concert with NPY5R, it induces angiogenesis and consequently plays an important role in revascularization and wound healing. On the other hand, when NPY acts through NPY1R and NPYR5, it acts as a vascular mitogen, leading to restenosis and atherosclerosis.
Statistics
?
PSSM-Id: 320520
View PSSM: cd15398
Aligned: 6 rows
Threshold Bit Score: 420.33
Threshold Setting Gi: 573882626
Created: 16-Dec-2013
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
  next features
Feature 1:putative peptide ligand binding pocket [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                #  ##           ###### #
O70342        63 YFLIGLYTFVSLLGFMGNLLILMAVMKKRNqkttVNFLIGNLAFSDILVVLFCSPFTLTSVlldqWMFGkamCHIMPFLQ 142 house mouse
NP_001072244  43 YFLIGLYTFVSLLGFMGNLLILLAIFKKRKqktiINYLIGNLAFSDILVVLFCSPFTLTCVlldqWIFGevmCHVVPFLQ 122 western clawed ...
NP_001026301  39 YFLIGLYTLISLAGFVGNLLVLTALTKRKQkt-iINILIGNLAFSDILVVLFCSPFTLTSVlldrWMFGtvmCHIMPFLQ 117 chicken
ABI94072      40 YFLIGLYAFVSLLGLFGNLLILTTLIRKWKqnslINFLIGNLAFSDILVVTFCSPFTLTGIlldqWIFGeimCHIVPFLQ 119 coelacanth
ACF22975      43 YLLVGIYIFISVLGILGNFCILVALYKNLKqksmINFLIGNLALSDILILLFCTPFTLTCLlldqWIFGevmCYIVPFVQ 122 elephant shark
XP_006629491  39 YFLIGLYTFISILGLLGNILILTALTRKWKektiINFLVGNLAFSDILVVLFCAPFTLTCVlldhWVFGdvmCHIVPFLQ 118 spotted gar
Feature 1        #  #                                          # #####                           
O70342       143 CVSVLVSTLILISIAIVRYHMIKHPISnnltaNHGYFLIATVWTLGFAICSPLPVFHslvelketfgsallsskYLCVES 222 house mouse
NP_001072244 123 CVSVLISTLMLMSIALVRYHMIKHPLStnltaNHGYFLIATVWTLGFTICSPLPVFHkiinlreafnldslinsYLCIES 202 western clawed ...
NP_001026301 118 CTSVLVSTLMLISIAAVRYRMVKYPLSsnltaKHGYFLIVIIWAVGCAICSPLPVFHkivdlhktlnlealenrLLCIES 197 chicken
ABI94072     120 CVSVMVSTLMLMCIAMVRFHMVSHPLSkhltvNTGYLLLGTLWTLGFTICSPLPVFHkiidlsedssleplknmYLCIES 199 coelacanth
ACF22975     123 CVSVMVSTLMLMSIAMVRYHMINHPLSnhvtiNTGYMLLGSVWIIGFTICSPLPIFHkvihlnetfdseslkirYLCIES 202 elephant shark
XP_006629491 119 CVSVMVSTLVLMSIAIVRYHMISHPLSrhlslNAGYILLGIIWTLALSICSPLPVFHktvdlsetfhleslknkSLCIES 198 spotted gar
Feature 1              #  ### ### ##                                                             
O70342       223 WPSdsyRIAFTISLLLVQYILPLVCLTVSHTSVCRSIscglshkenrleeneminltlhpskksrdqakppstqkwsysf 302 house mouse
NP_001072244 203 WPSdsyRIAFTISLLLVQYILPLSCLTISHTSVCRSIgsrlpsrdtkveeneminltlqqpknhrseleisssrrwsysc 282 western clawed ...
NP_001026301 198 WPSdsyRIAFTISLLLMQYILPLVCLTASHTSVCRSVgsrlsskegkfqeneminltlhpsksagteaqpsshtswscal 277 chicken
ABI94072     200 WPSgsyRIAFTICLLFVQYILPLVCLTVSHTSVCRSVssrmpskkarfeeneminltlqqpeknrpqakhcsrrrwsysl 279 coelacanth
ACF22975     203 WPSnsyRIAYTISLLFIQYILPIVCLTISHASVCRKVsaampskqsgfeeneminltihqpaqnqsrmklskmqgwgysf 282 elephant shark
XP_006629491 199 WPSggyRTAFTISLLFVQYILPLVCLTVSHASVCRRVsssvpshlqvqteekeminltlqqpnqksciptqftdsekwkl 278 spotted gar
Feature 1                                                                                        
O70342       303 irkhrrryskktacvlpa-----pagpsqekhltvpenpgsvrsqlspsskvipgvpicfevkpeessdaqemrvkrslt 377 house mouse
NP_001072244 283 vrkhrrryskksasvvpai---lrrnqesntgdipetsmtershtlpssvylpgvpicfemkpeensemhnmisvsksit 359 western clawed ...
NP_001026301 278 vrkhhrryskktstvmpai---lrqqqdadfrdlpetsgteksqlsssskfipgvpicfemkpeenteiqdmitvsqsii 354 chicken
ABI94072     280 vrkhrkryskkrasvvpai--lkqekentssgellgtpnvqsshasptaiflpgvpicfeakpdenpelqkmlatsksis 357 coelacanth
ACF22975     283 vrkhkkrysrkcasvvpamvkvhkneptrddllvtpgsestqplptsflpgvpvcfemkataaeeaiepqhvyvtpksvt 362 elephant shark
XP_006629491 279 vlaqkqrkrynkktssv-------vpamyshendsaeylhpqsqhhpstlllsgvpvcfelkeeeatelhkmltisksis 351 spotted gar
Feature 1                               #  ## ##  #           ## ###  #  ##                     
O70342       378 rikKRSRSVFYRLTILILVFAVSWMPLHVFHVVTdfndnlisnrhFKLVYCICHLLGMMSCCLNPILYGFLNngIKADL 456 house mouse
NP_001072244 360 rirKRSRRVFCRLTILIIAFAVSWMPLHLFHLVTdfnanlisnrhFKLVYCICHLLGMVSCCLNPILYGFLNdgIKADL 438 western clawed frog
NP_001026301 355 rikTRSRRVFCRLTVLILVFGFSWMPLHLFHIVTdfnatlisnrhFKLVYCICHLLGMMSCCLNPILYGFLNnsIKADL 433 chicken
ABI94072     358 riqRRSRQVFYKLTIVVLVFAISWMPLHIFQLATdfnanlisnrhFKLVYCICHLLGMLSCCLNPILYGLLNngIKSDL 436 coelacanth
ACF22975     363 rlrKRSRSVFYRLTIVIIAFAVSWMPLNLFILLTdingnlissrhFKLVYCICHLLGMLSCCLNPILYGFLNngIKSSL 441 elephant shark
XP_006629491 352 rmkKRSKSVFFKLTIVVLAFAISWMPLHIFHLVTdfsanhissrhFKLIYCICHLLGMLSCCLNPVLYGFLNngIKSDL 430 spotted gar

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap