Conserved Protein Domain Family
MFS_MFSD6L

?
cd17479: MFS_MFSD6L 
Major facilitator superfamily domain-containing protein 6-like and similar transporters of the Major Facilitator Superfamily
Major facilitator superfamily domain-containing protein 6-like (MFSD6L) protein family includes a group uncharacterized proteins similar to human major facilitator superfamily domain-containing protein 6 (MFSD6). MFSD6 is also called Macrophage MHC class I receptor 2 homolog (MMR2). It has been postulated as a possible receptor for human leukocyte antigen (HLA)-B62. The MFSD6L family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
Statistics
?
PSSM-Id: 341032
Aligned: 10 rows
Threshold Bit Score: 333.508
Threshold Setting Gi: 555704088
Created: 12-May-2017
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative
Feature 1:putative chemical substrate binding pocket [chemical binding site]
Evidence:
  • Comment:based on the structures of MFS transporters with bound substrates, substrate analogs, and/or inhibitors
  • Comment:since MFS proteins facilitate the transport of many different substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides, the residues involved in substrate binding may not be strictly conserved among superfamily members
  • Comment:the substrate binding site or translocation pore has access to both sides of the membrane in an alternating fashion through a conformational change of the MFS transporter

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             ##  ##  #                               #                                
Q8IWD5      16 AKLFHLVCGVREACVTPFLTlylrqlglaapwVGTLMGTKHLIAAFWAPVCAFLAKsyrkrRALLIGSLLGSVGASLLmv 95   human
EMP23720   715 ASLFHFLYSAGNACVIPFLTlyfrqlgltaplVGIIIGIKHLISSLWAPLCSYFAKshskrKVLITGSLLCSVGTGLLlt 794  green sea turtle
ESO07321    13 ANAFSFFYSAGQSCLIPFLSyyflylgltplqTGLLLGVKAITSGLSNVFWNLCVAttakrSKCILIFSLTVLMFSHLim 92   Helobdella robusta
OAF70399    14 MSTYYFASNSANAALMPFLPlfyravglnaflMGLLYASYKTSTIFGTIFWPSLCRvycsaRSNILVSIMITLVLYMImt 93   Intoshia linei
ESO89262    30 CNLFHFFFAASKACLLPFLTvflrrlgmtateTGIIIAFKTITGFVWAPLWARCAIsynkrRFVLMFSVLMFAASYLSlt 109  owl limpet
Q6DBX0      21 ASVFHFLHSCGSGCLLPFLTlyfrhlglsaamIGIIMASKHLLALLWRPFSSVLARqydkrRTVIVGSLLSSALVVLPll 100  zebrafish
Q68EU6      16 ATLFYFFHNVGKFCLMPFLTlyfrqlglgaplVGIIFGFKHAVHLLWAPLCSFLAKnhhkqRFFIMTSLLLSAGVGSLfa 95   African clawed frog
Q5XGZ9      16 ATLFHFFHNVGKFCLMPFLTlyfrqlglgaslVGIIIGFKHAVHLLWAPLCSFLAKshrkrRFFIMASLLLSAGAGGLfa 95   African clawed frog
EEN51751    16 AKAFYFLNHAGKACLLPFLPlyfrllglsatqVGIICGTRAFIGLWAAPVWAKMAKkynirRLVILFALFMTIACTLSlt 95   Florida lancelet
ELU10490     8 SYIFHLFFGAGQSCLLPFLSlyfrylgltasqVGIVFGAKAAVNMIWAPCWTRCSTkfrkkRFVMVFSMFILLGTYGLmi 87   Capitella teleta
Feature 1                                                                                      
Q8IWD5      96 lvppvdknrvhfpcngssgltstdalpgvtlpvnitsaqesasshpakrtaevempgfrnppgesdretfrd-------- 167  human
EMP23720   795 lvpplskdvmykycnisqqsssllnaievpdmslnnlsavnpntvtnkemvsaetlrtatnvlvmsgkppltssafqelf 874  green sea turtle
ESO07321    93 vllpsldkeksekfcisynnfnktdwgisennaskknvsddgglegfnytslyvngsingsvngstlisnvnvgttntrn 172  Helobdella robusta
OAF70399    94 tvplkfdpiktqfypqciqsensislhnllknffhsnasipfnnttqkinvekdlsdllrdvefsnlndsvvntewqsyy 173  Intoshia linei
ESO89262   110 vvyqhtsnydmcnnsldssnrlvlpsylkplfgsdssksndkipanpqytsaipentstnpklasefpeststismstnv 189  owl limpet
Q6DBX0     101 lfpsagilvesgrcntsqpdadptlplavieqmtvpvgsnatvysv---------------------------------- 146  zebrafish
Q68EU6      96 yyppldknivslfcntsmpwkeqlnppidisvsvdenlnttyaaptdhqtttgalntlpssvgklatdpamtsldleitt 175  African clawed frog
Q5XGZ9      96 fyppldknivslfcntsmpwkeqlnppidisvfvdenisttyatptnhqttngefntfpssvaevaidttmassldmktt 175  African clawed frog
EEN51751    96 vippidedytskfcpgnstdgaeekgtvtgliheglqgsmggntstdmsnteedfqqpangekihsddelateetfvnst 175  Florida lancelet
ELU10490    88 iippasqeisdlhanpsdlitstsldlttellpnpsstlsitvsvdi--------------------------------- 134  Capitella teleta
Feature 1                                                                                      
Q8IWD5         --------------------------------------------------------------------------------      human
EMP23720   875 tfmdaqkkngertgevgttadhyh-------------------------------------------------------- 898  green sea turtle
ESO07321   173 fsidttttsvfvvqqrtdknvrddggghskhssssssssnnssssssssssssssssgnenndnnineagnsqqfnqkrs 252  Helobdella robusta
OAF70399   174 dkfmnklntdqknsiknlnisqddwklmsdkdytylyntlddldkqmqskplkrnrrnl--------------------- 232  Intoshia linei
ESO89262   190 pstt---------------------------------------------------------------------------- 193  owl limpet
Q6DBX0         --------------------------------------------------------------------------------      zebrafish
Q68EU6     176 hq------------------------------------------------------------------------------ 177  African clawed frog
Q5XGZ9     176 thqrf--------------------------------------------------------------------------- 180  African clawed frog
EEN51751   176 e------------------------------------------------------------------------------- 176  Florida lancelet
ELU10490       --------------------------------------------------------------------------------      Capitella teleta
Feature 1                                                                                      
Q8IWD5         --------------------------------------------------------------------------------      human
EMP23720   899 -----------------------------------------------------------------------------nrp 901  green sea turtle
ESO07321   253 vnwresnnensgnnnnnsnnnnsssssnssnnnnnnkskmdgynndgaeidegvndfyadnrinnfknpdgktplkssvf 332  Helobdella robusta
OAF70399   233 -------------------------------------------fdikrkegnykmkkqkknnprynffnidefidepnvh 269  Intoshia linei
ESO89262       --------------------------------------------------------------------------------      owl limpet
Q6DBX0         --------------------------------------------------------------------------------      zebrafish
Q68EU6         --------------------------------------------------------------------------------      African clawed frog
Q5XGZ9         --------------------------------------------------------------------------------      African clawed frog
EEN51751       --------------------------------------------------------------------------------      Florida lancelet
ELU10490       --------------------------------------------------------------------------------      Capitella teleta
Feature 1                                                                                      
Q8IWD5     168 -----------------------------lhvylapsvegarttsqallhpvtsglkdhpwevtfevvktalpllpggkg 218  human
EMP23720   902 sgkiasmnainqmiqeletlasnetqirrleketktpevellnvngnpeknlsiggstefslfqtnphpagrasyvfenl 981  green sea turtle
ESO07321   333 iggkksipppslsspsslsssslssssssissasptsppnetstssssissssfsssssintsfsstllsfsstslsiss 412  Helobdella robusta
OAF70399   270 sykgkkhkhakkiaqneikndqiitqpttqpttttttttpmkiekkttiimkteiektkamdttlklkiikdaenlneny 349  Intoshia linei
ESO89262   194 -----------------tnlpttelpttlsmkttigtvippinepstpsqdqllqvaqeeesqaqvkqesqtqanhrvkr 256  owl limpet
Q6DBX0     147 -------------------------------------------------------nqtsvstnqtledntlvnhsrsarg 171  zebrafish
Q68EU6     178 -------------------rftdqfpvtsntilehqtknvlgsgkaqkvmssksaasnskqrsslnnhtspyathpnvsh 238  African clawed frog
Q5XGZ9     181 -----------------tdqfpssspltrnkrlehqtrkvlgsgkaqkansskssasnskqrsslnnqtapfathpnvsh 243  African clawed frog
EEN51751   177 --------------------vaqqsasqeaissgpflqnnqgniqntglsqstlsetmlptekrsrydklhqlnenldtr 236  Florida lancelet
ELU10490   135 -------------------------------------------------------nasttpaplssttpvsllnyfsqds 159  Capitella teleta
Feature 1                                       ## ###  #                           #  ##  #   
Q8IWD5     219 pgnpanlsgtkgkawafdlsleaLRRTFILSLGSVAFWELLTAPleqvaddslyefldfvdatdrYRSLWVWRLLGMSAG 298  human
EMP23720   982 sshsekvrdvnfellqdisfldrEHQIFLMVLGAVVFWELLAAPlewmvddslyeyldfvdatdrYGKLWVWSYLGASGG 1061 green sea turtle
ESO07321   413 ttlstlssssssslptdkleyirDQIFGAMLILIIVCELFSSPVktlsselyvdflqssnqvltrRKTTSCWSALAAVSF 492  Helobdella robusta
OAF70399   350 lmgsvlsvfkkrldkihqkiyssPKHSFVLMLVILILVGLLSPPhnrvvdnawfeyldtiemsesFSNHKIWKLLGYAVV 429  Intoshia linei
ESO89262   257 siksswddamkrseslwtnmdseKIQLFLLVLLVIIIGELLSCAiekvaddswfdfldriddlekYGKQRLGGNFAFVFF 336  owl limpet
Q6DBX0     172 lrslkkeeephseflgslkvmdaQHQMFFLVLLVTALWEFVAVPlewtaddglyeyldfvdatdrHSGVKVWKHVGAAFG 251  zebrafish
Q68EU6     239 hpsiherkvrdigidftdnsldpQHKIFLIVLVLVIIWEILAAPlewiaddslyeyldfvdatdrHGKLWIWGYLGASMG 318  African clawed frog
Q5XGZ9     244 rpsiherkvrdisidftdsfldpKHKIFLIVLAMVIIWEILAAPlewiaddslyeyldfvdatdrHGKLWIWGYLGASMG 323  African clawed frog
EEN51751   237 qdkekpkeksyyrdysenndypqYYRTFLIVLIVIIIGELLTSQvekicddslyefldnlddiekYGQQKYWSSLGIAIC 316  Florida lancelet
ELU10490   160 vynsfanimnhihelpkqintviYEKVFAAVMALIIVGEMFSAPaekladdtwfefldssdllekYGTHKMWMALGCALL 239  Capitella teleta
Feature 1                                                                                      
Q8IWD5     299 VCGITALVGqldcflmt----------------------------sgprgvvHFYGYSVVSTLALLVSIAFpipicqqwe 350  human
EMP23720  1062 ACSITIFVDqlncflsa----------------------------kisrlsvHFYGYAVLITLTLLISVFLpihvskkte 1113 green sea turtle
ESO07321   493 PWFVVLLIDhlpchvpp---------------------------lnlsrilfHFWTFFLIHILSLLLCVFYpipvpdaiq 545  Helobdella robusta
OAF70399   430 PFITVLIVIasskcnvisfwyptmnlsstpqfetfpyfyinaservsskyllHFYLYAGFMILSIPLVFLLnpmkrsyse 509  Intoshia linei
ESO89262   337 PIGISLLVHytdcmlpl----------------------------yinhfllHFYMFGGFLAITFVVAFFYpipppqkqe 388  owl limpet
Q6DBX0     252 SCLVGVLVTnlfcr---------------------------------ignsvEFYSYTVLMILTVPASALLpiylrkrer 298  zebrafish
Q68EU6     319 SIFITFLVDnlncfviy----------------------------diprvffHFFCYGGFLIGTLFLSTLYpihvskkte 370  African clawed frog
Q5XGZ9     324 SIFITFLIDnlncfvif----------------------------diprvsfHFFCYGGFLISTFFLSTLYpvhvskkte 375  African clawed frog
EEN51751   317 ATGVTALVDntdcflnq----------------------------ginhfmiHFYTFSGVVGLAFLLALFYpihpvckeh 368  Florida lancelet
ELU10490   240 PPVLTTAIDrlpcllaelg------------------------qykihrillHFFAFYVLMGLAFVCSICFpiystkdgk 295  Capitella teleta
Feature 1                                                               #  ##  ###  #          
Q8IWD5     351 psy---------------------------------krvkalsivggdPHLILLASTTVLVGAIVSTVQNFLfwhmkd-- 395  human
EMP23720  1114 hvn---------------------------------ktvkalnligsdGRTILSAVTVFLTGVIGSTVQNFLfwqmqd-- 1158 green sea turtle
ESO07321   546 edgekstgsrhrrr------------rrshvinkwesvckglkligleGRSVLSAVTVLIVGFCGGVLVLFVpwfmhefi 613  Helobdella robusta
OAF70399   510 lssapskktkmyksnvyehlpisdedshiipphtpilvnrglrmcfgsMTAAVYTITFFIFEMIKSLEQLFLfwslvd-- 587  Intoshia linei
ESO89262   389 fns---------------------------------kvvqglkiiccdCQAFLYILTLLIMGLVYSSYHNFLfwvied-- 433  owl limpet
Q6DBX0     299 pts---------------------------------ggfkalqlvhgnPQAILCAVTVILTGMVTSAVSDFLlwlmqd-- 343  zebrafish
Q68EU6     371 hsn---------------------------------ktvkalgflgsdGRIVLTALTVFLLGAVGSTTQNFLfwqmqd-- 415  African clawed frog
Q5XGZ9     376 hsn---------------------------------ktvkalgflgsdGRIVLTALTVFVLGAVGSTIQNFLfwqmqd-- 420  African clawed frog
EEN51751   369 nqr---------------------------------kisksfrllltdCRNICYLLTVFVAGGLASTIHNYLfwlvqd-- 413  Florida lancelet
ELU10490   296 kvlqr-----------------------------rgrfcrglrmlfhdVQVSTFTISVLLMGFVQGATSTFLfwliqd-- 344  Capitella teleta
Feature 1                        #   #                                           ##   #   #    
Q8IWD5     396 hgsgelVMGFSVALSLLGEILLHPFKATLlrk-lsRTGLVGLGLSCLAGQLLyysflwsWWSVLPIQILSAISNRALWWA 474  human
EMP23720  1159 rgsselYMGLSVAIGLIAEILLYIFKSKLlra-lsSSGTVALSLSCLSAQLLyysflwnAWSVLPIQMLCAFSNGALWWA 1237 green sea turtle
ESO07321   614 kdgselFIGATIGLAAAGDLVCTFFGDWLsrk-sgHIICILIGLLLTGARLAfygffnqPLLALAVESSNVVGGALVVAA 692  Helobdella robusta
OAF70399   588 vggnglHFSLFISVASVSQILFSIILSRKfntkilKRKIIFIVVLISMIQCVvysfsfnPWYILIGATLSAFGRPLFKDT 667  Intoshia linei
ESO89262   434 lgggelNMGMCVSIGAFAEIPMLMISQKMvkk-mgNAGVVSLALFFLSMRVLyysflptPWAVMPAELLHAFTHTAMWFA 512  owl limpet
Q6DBX0     344 cgameiHMGICLALAHLSHTGFSPIAGPLsrflkyHGWMLVLAVVGLAMQCLyysflwsPWAVMPAQLLAGFSTGALWWS 423  zebrafish
Q68EU6     416 vgsselYMGLSIAVGLLSELTLYFFRNKLlki-ftFKWMVALGLFSLGVQCLyysflwaPWSVLAIQILNAFSSGVIWWA 494  African clawed frog
Q5XGZ9     421 igsnelYMGLSIAAGLLSELALYFFRNKLlkt-ltFKWMVVLGLLSLGIQFLyysflwtPWSVVAIQILNAFSSGVIWWA 499  African clawed frog
EEN51751   414 kggseiIMGLSVTVSTCAEIPMMFLGNWLikr-vtHAGLVSIAFLGLSVRFLyysllwtPWAVVPIELLHSFSYGAFWGA 492  Florida lancelet
ELU10490   345 ktgaeqIMGLCLAAAFAGEFFMQGFGRWLvsk-vgYAPCVVFGLLVLGGRFAfysliadPMYIIAGEGFHCLSVSLIWDA 423  Capitella teleta
Feature 1                                  #  ##  ##  #                                   
Q8IWD5     475 VGAsvedlat----------prmeraLSALFRGHFYGSGCSLGSFvggfvvmrfsLAVLYQACCVALLLWLALLL 539  human
EMP23720  1238 VNMlvddvas----------pgteraLHIVLQGLSYGCGATVGSFaggfvvsnfgLAVLYRACSISLALWLILFL 1302 green sea turtle
ESO07321   693 AHDqpiflhqrklknknshsalastmSIESALKMMRRIGFGVGCIvsgliyqrygRKMAFWSSGMVAASWFLMFA 767  Helobdella robusta
OAF70399   668 LEKldefvvi---------nwqmdrsVDLVLRGLIAPFGYALGAMmfgyfyeklgISILFQATTGVLGLWLIFLI 733  Intoshia linei
ESO89262   513 VLSyddfnvg----------amidrsIRSILSSIYFGVGFTLGCLisgliydifgYAILYQAASVLVGIWFIIFS 577  owl limpet
Q6DBX0     424 VTSqsediat----------pgtektILRLFEAFSLDMGAALGSLiagfvvqkfgVNVLFQGASVMLAVWSSALA 488  zebrafish
Q68EU6     495 INSqvvdlas----------pgtersLQLALRWLAYGCGSSTGSFasgfiisrfsLAVLYQACCITLLLWIIIFL 559  African clawed frog
Q5XGZ9     500 INSqvvdvas----------pgtersLQLTLRWLAYGCGSSAGSFasgfiisrfsLAVLYQACCITLLTWIVIFL 564  African clawed frog
EEN51751   493 IMGyaehisp----------pgiertVQAIIAAIYWGLGFGTGSMvsgviydkygVAILYRAACIVSVVWCLGFV 557  Florida lancelet
ELU10490   424 VRTypdfrln---------plvmdrsANSVMNAFYHGIGLAPGCFtagyiydwvgLPILFQSCAVLCGVWAVIFA 489  Capitella teleta

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap