3VW7,4PHU,4XNW,4PXZ


Conserved Protein Domain Family
7tmA_purinoceptor-like

?
cd14982: 7tmA_purinoceptor-like 
Click on image for an interactive view with Cn3D
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors
Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.
Statistics
?
PSSM-Id: 341318
View PSSM: cd14982
Aligned: 37 rows
Threshold Bit Score: 153.96
Threshold Setting Gi: 665764643
Created: 23-Sep-2008
Updated: 26-Jul-2017
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 47 residues -Click on image for an interactive view with Cn3D
Feature 1:putative ligand binding pocket [chemical binding site]
Evidence:
  • Comment:based on the structures of some class A family members (including purinoceptor-like subfamily members) with bound ligands (peptides or chemicals), agonists, or antagonists
  • Comment:Small-molecule chemical ligands tend to bind deeper within the receptor core, compared to a peptide ligand neurotensin, which binds towards the extracelllular surface of its receptor.
  • Structure:4PXZ: Human P2Y12 receptor binds 2MeSADP, a close analogue of endogenous agonist ADP; contacts at 4A
    View structure with Cn3D
  • Structure:3VW7: Human protease-activated receptor 1 (PAR1) bound with antagonist vorapaxar, contacts at 4A.
    View structure with Cn3D
  • Structure:4XNW: Human P2Y1 Receptor binds nucleotide antagonist MRS2500; contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                               #  ##            ###### #
3VW7_A        21 LFVPSVYTGVFVVSLPLNIMAIVVFILKMKvkkpAVVYMLHLATADVLFVSVLPFKISYYFsgsdwqfgselCRFVTAAF 100
4PXZ_A        35 VLFPLLYTVLFFVGLITNGLAMRIFFQIRSks-nFIIFLKNTVISDLLMILTFPFKILSDAklgtgplrtfvCQVTSVIF 113
Q9BXC1        20 FIYAVTYTVILVPGLIGNILALWVFYGYMKetkrAVIFMINLAIADLLQVLSLPLRIFYYLnhdwp-fgpglCMFCFYLK 98  human
O14626        15 EPFTYFFYLVFLVGIIGSCFATWAFIQKNTnhrcVSIYLINLLTADFLLTLALPVKIVVDLgvapwklkifhCQVTACLI 94  chimpanzee
Q7Z602        17 TPHLISLYFIVLIGGLVGVISILFLLVKMNtrsvTTMAVINLVVVHSVFLLTVPFRLTYLIkktwm-fglpfCKFVSAML 95  human
NP_001007218  69 PSLPIGYIIICCVGLLCNTITLYIFFLRRHiessMAVYMQHLALADTLLVLCLPLRVYYHNtagp----fsvCKAVGVLF 144 zebrafish
Q9UPC5        55 TVLTTSYSVIFIVGLVGNIIALYVFLGIHRkrnsIQIYLLNVAIADLLLIFCLPFRIMYHInqnkwtlgvilCKVVGTLF 134 human
Q9H244        26 VLFPLLYTVLFFVGLITNGLAMRIFFQIRSks-nFIIFLKNTVISDLLMILTFPFKILSDAklgtgplrtfvCQVTSVIF 104 human
XP_420148     20 TLYAATYTIIFIPGLLANSAALWVLCRFISkkskAVIFMINLAVADLAHVLSLPLRMYYYInhtwp-fgtflCQLCFYLK 98  chicken
NP_001082996  28 HLYTYFYLIIFIPGVLSNTLALWVLCRFVSkktkAIIFMINLTVADLAHVLSLPLRIHYYIqqdwp-fgnelCLLCFYLK 106 zebrafish
Feature 1        #  ##                                          ## #####               ####      
3VW7_A       101 YCNMYASILLMTVISIDRFLAVVYPmqSLSWRtlGRASFTCLAIWALAIAGVVPLllkeqtiqvpglgiTTCHDvlset- 179
4PXZ_A       114 YFTMYISISFLGLITIDRYQKTTRPfkTSNPKnlLGAKILSVVIWAFMFLLSLPNmiltnrq-prdknvKKCSFlkse-- 190
Q9BXC1        99 YVNMYASIYFLVCISVRRFWFLMYPfrFHDCKq-KYDLYISIAGWLIICLACVLFpllrtsd-dtsgnrTKCFVdlptrn 176 human
O14626        95 YINMYLSIIFLAFVSIDRCLQLTHSckIYRIQepGFAKMISTVVWLMVLLIMVPNmmipikd-ikeksnVGCMEfkke-- 171 chimpanzee
Q7Z602        96 HIHMYLTFLFYVVILVTRYLIFFKCkdKVEFYrkLHAVAASAGMWTLVIVIVVPLvvsrygi-heeyneEHCFKfhke-- 172 human
NP_001007218 145 YINMYSSILFLTLISLDRYLKIIKPvwVFSIQkkXWSXKASYGVWVLLILGMIPFligsgq---khacdNICFHfhs--- 218 zebrafish
Q9UPC5       135 YMNMYISIILLGFISLDRYIKINRSiqQRKAIttKQSIYVCCIVWMLALGGFLTMiiltlk--kgghnsTMCFHyrdk-- 210 human
Q9H244       105 YFTMYISISFLGLITIDRYQKTTRPfkTSNPKnlLGAKILSVVIWAFMFLLSLPNmiltnrq-prdknvKKCSFlkse-- 181 human
XP_420148     99 YLNMYASICFLTCISIQRYLFLLHPfkATAWKr-RYDVGLSAAVWLFVGAACLPLpivrsp--alsnstTTCFSdlavkq 175 chicken
NP_001082996 107 YLNMYASIAFLVCISIQRCGFLMHPfhARRWKs-RYDVCISITVWVVVGLCCSPFilmrsks-nsslgnRSCFKdlpmrk 184 zebrafish
Feature 1             #  ### ### ##                                                              
3VW7_A       180 llegyYAYYFSAFSAVFFFVPLIISTVCYVSIIRClsssanifemlrideglrlkiykntegyytigighlltkspslna 259
4PXZ_A       191 -fglvWHEIVNYICQVIFWINFLIVIVCYTLITKElyrsyvrtadlednwetlndnlkviekadnaaqvkdaltkmraaa 269
Q9BXC1       177 vnlaqSVVMMTIGELIGFVTPLLIVLYCTWKTVLSlqdkyp--------------------------------------- 217 human
O14626       172 -fgrnWHLLTNFICVAIFLNFSAIILISNCLVIRQlyrnk---------------------------------------- 210 chimpanzee
Q7Z602       173 --layTYVKIINYMIVIFVIAVAVILLVFQVFIIMlmvqkl--------------------------------------- 211 human
NP_001007218 219 --kgiVAGGVNISTVVIFIIFYIVFISFYIKIIHKlkgmsl--------------------------------------- 257 zebrafish
Q9UPC5       211 -hnakGEAIFNFILVVMFWLIFLLIILSYIKIGKNllriskr-------------------------------------- 251 human
Q9H244       182 -fglvWHEIVNYICQVIFWINFLIVIVCYTLITKElyrsyvr-------------------------------------- 222 human
XP_420148    176 ltpgaSIALVTVAELFGFVIPFGIIAWCTWKMRQSlqeggt--------------------------------------- 216 chicken
NP_001082996 185 lnfqlAISMMAAAELFGFLGPLFIIGFCNYLIENSmrqrnk--------------------------------------- 225 zebrafish
Feature 1                                                                                        
3VW7_A       260 akseldkaigrntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrml 339
4PXZ_A       270 ldaqkatppkledks-------------------------------------------------pdspemkdfrhgfdil 300
Q9BXC1           -------------------------------------------------------------------------------- human
O14626           -------------------------------------------------------------------------------- chimpanzee
Q7Z602           -------------------------------------------------------------------------------- human
NP_001007218     -------------------------------------------------------------------------------- zebrafish
Q9UPC5           -------------------------------------------------------------------------------- human
Q9H244           -------------------------------------------------------------------------------- human
XP_420148        -------------------------------------------------------------------------------- chicken
NP_001082996     -------------------------------------------------------------------------------- zebrafish
Feature 1                                                                       #  ## ##  #      
3VW7_A       340 qqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayanrSKKSRALFLSAAVFCIFIICFGPTNVLLIAHysflsh 419
4PXZ_A       301 vgqiddalklanegkvkeaqaaaeqlkttrnayiqkylrgvgkVPRKKVNVKVFIIIAVFFICFVPFHFARIPYtlsqtr 380
Q9BXC1       218 --------------------------------------maqdlGEKQKALKMILTCAGVFLICFAPYHFSFPLDflvksn 259 human
O14626       211 --------------------------------------dnenyPNVKKALINILLVTTGYIICFVPYHIVRIPYtlsqte 252 chimpanzee
Q7Z602       212 -------------------------------------rhsllsHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYlnvvth 254 human
NP_001007218 258 --------------------------------------gngdlKAKKRVMIKTFLVPAIFTVCFLPYHAVRIPYvlaqld 299 zebrafish
Q9UPC5       252 ------------------------------------rskfpnsGKYATTARNSFIVLIIFTICFVPYHAFRFIYissqln 295 human
Q9H244       223 -------------------------------------trgvgkVPRKKVNVKVFIIIAVFFICFVPFHFARIPYtlsqtr 265 human
XP_420148    217 --------------------------------------qlqstSEKQKALRMVLMCAAVFFICFTPYHINFPFFmmvien 258 chicken
NP_001082996 226 --------------------------------------qqqstSDTRKALRMVRVCTGVFLFCFAPYHINFLLYlmvsqs 267 zebrafish
Feature 1                  ## ###  #  ##                      
3VW7_A       420 ----tstteaAYFAYLLCVCVSSISCCIDPLIYYYASs-eCQRYV 459
4PXZ_A       381 dvfdctaentLFYVKESTLWLTSLNACLNPFIYFFLCk-sFRNSL 424
Q9BXC1       260 eiksclarrvILIFHSVALCLASLNSCLDPVIYYFSTn-eFRRRL 303 human
O14626       253 vitdcstrisLFKAKEATLLLAVSNLCFDPILYYHLSk-aFRSKV 296 chimpanzee
Q7Z602       255 ----snacnsKVAFYNEIFLSVTAISCYDLLLFVFGGshwFKQKI 295 human
NP_001007218 300 viadlpsqqlLHVLNESTLLLSTLNSCLDPIIYYFLSs-sYRKTI 343 zebrafish
Q9UPC5       296 vs-scywkeiVHKTNEIMLVLSSFNSCLDPVMYFLMSs-nIRKIM 338 human
Q9H244       266 dvfdctaentLFYVKESTLWLTSLNACLDPFIYFFLCk-sFRNSL 309 human
XP_420148    259 iikdctvhsnTLRFHPISLCLASLNCCLDPVLYYFMTs-eFQDQL 302 chicken
NP_001082996 268 iitnceasqvIKQFHPISLCMASLNCCLNPLIYYFLTt-eFKQQL 311 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap