Conserved Protein Domain Family
ArfGap_ARAP2

?
cd08856: ArfGap_ARAP2 
ArfGap with Rho-Gap domain, ANK repeat and PH domain-containing protein 2
The ARAP subfamily includes three members, ARAP1-3, and belongs to the ADP-ribosylation factor GTPase-activating proteins (Arf GAPs) family of proteins that promotes the hydrolysis of GTP bound to Arf, thereby inactivating Arf signaling. The function of Arfs is dependent on GAPs and guanine nucleotide exchange factors (GEFs), which allow Arfs to cycle between the GDP-bound and GTP-bound forms. In addition to the Arf GAP domain, ARAPs contain the SAM (sterile-alpha motif) domain, 5 pleckstrin homology (PH) domains, the Rho-GAP domain, the Ras-association domain, and ANK repeats. ARAPs show phosphatidylinositol 3,4,5-trisphosphate (PI(3,4,5)P3)-dependent GAP activity toward Arf6. ARAPs play important roles in endocytic trafficking, cytoskeleton reorganization in response to growth factors stimulation, and focal adhesion dynamics. ARAP2 localizes to the cell periphery and on focal adhesions composed of paxillin and vinculin, and functions downstream of RhoA to regulate focal adhesion dynamics. ARAP2 is a PI(3,4,5)P3-dependent Arf6 GAP that binds RhoA-GTP, but it lacks the predicted catalytic arginine in the RhoGAP domain and does not have RhoGAP activity. ARAP2 reduces Rac1oGTP levels by reducing Arf6oGTP levels through GAP activity. AGAP2 also binds to and regulates focal adhesion kinase (FAK). Thus, ARAP2 signals through Arf6 and Rac1 to control focal adhesion morphology.
Statistics
?
PSSM-Id: 350081
View PSSM: cd08856
Aligned: 4 rows
Threshold Bit Score: 230.565
Threshold Setting Gi: 528756581
Created: 15-Feb-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Zn binding sitearginine finger
Feature 1:Zn binding site [ion binding site]
Evidence:
  • Comment:the coordination of the Zn2+ ion by 4 cysteines would indicate that this ion plays a structure stabilization rather than catalytical role.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                             #  #                #  #                                    
NP_056045     680 ETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDaSIWSNELIELFIVIG 759  human
OCT96769      575 ETLADYEVAEKIWFNEYNRRCADCRAPSPDWASISLGVVICKNCAGQHRSLGSNISKVHSLILDtTIWSNELVELFIVVG 654  African clawe...
EPY76240      483 ETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDaSIWSNELIEALCAAV 562  wild Bactrian...
XP_022056188  658 ETLYDYEVAEKIWFNEANRSCADCRAPKPEWASVNLGVVICKKCAGQHRSLGPSISKVRSLKYDsSIWSNELVELFLKVG 737  spiny chromis
Feature 1                                                   
NP_056045     760 NKRANDFWAGNLQKDEEL-HMDSPVEKRKNFITQKYKEGKFR 800  human
OCT96769      655 NEKVNNIWEANLLPENML-HMDSDVSQRRLFITQKYKEGRFK 695  African clawed frog
EPY76240      563 VKPDVLETMALLFSGADVmCATGDPEYSTPYLLAKKAGQSLQ 604  wild Bactrian camel
XP_022056188  738 NRNANSFWAANLPLEEDL-HSGASAEQRATFIRRKYRERKYR 778  spiny chromis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap