Conserved Protein Domain Family
Ion_trans

?
pfam00520: Ion_trans (this model, PSSM-Id:366146 is obsolete and has been replaced by 395416)
Ion transport protein
This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.
Statistics
?
PSSM-Id: 366146
View PSSM: pfam00520
Aligned: 243 rows
Threshold Bit Score: 39.9557
Threshold Setting Gi: 62901475
Created: 22-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q25150        130 HSVFNSVIMLTILVNCGFMAY----GEd----------------------VD---IV--EKTFLAIYTFEAVVKIFSRGF 178  Halocynthia r...
Q9XXD1        229 AQAFAVCSVVFVLISISGLVLgslpELqvatkqrnnl---tgeeftemepMPilgYI--EYVCIVWFTMEYGLKMLVSAE 303  Caenorhabditi...
O73606        216 GKIFACISISFVAITAVSLCIstmpDVreeed-------------rgecsQKcydIFvlETVCVAWFSFEFLLRSIQAEN 282  chicken
2_pfamImport    1 GKVFACLSVLFVTVTAVNLSVstlpSLreeeeq-----------ghcsqmCHnvfIV--ESVCVGWFSLEFLLRLIQAPS 67  
P97557        212 ARIFGVISIIFVAVSIVNMALmsaeLSwl--------------------nlQlleIL--EYVCISWFTGEFILRFLCVKD 269  Norway rat
Q9BQ31        184 AKLIAISSLSVVLASIVAMCVhsmsEFqned---------------gevdDPvleGV--EIACIAWFTGELAVRLAAAPC 246  human
O35173        188 SKLFSCVSIGVVLASIAAMCIhslpEYqareaaaavaavaagrsaeevrdDPvlrRL--EYFCIAWFSFEVSSRLLLAPS 265  house mouse
P17971        184 ALVFYYVTGFFIAVSVMANVVetvpCGhrpgragt--------lpcgeryKIvffCL--DTACVMIFTAEYLLRLFAAPD 253  fruit fly
P91784        201 ARILYYITGFFIAVSVGSTIIetidCSanrpc--------------gevyNKiffNI--EAVCVVVFTIEYLARLYSAPC 264  penicillate j...
O76266        209 AYAVAFISVIMTTISIILFCVetleRFakshcva----------deapnfLDpffII--ETICTAWFTFEAIVRFISCPN 276  medicinal leech
Q25150        179 ilsSFTYLRDPWNILDISVIFTAYLdivmalaqkasdggKA---------------QK---------------------- 221  Halocynthia r...
Q9XXD1        304 ---RSKTFRQLLNIIDLLAILPFII--------------EMlll---------ifgISteqlr-------------dlkg 344  Caenorhabditi...
O73606        283 ---KCAFLKTPLNIIDILAILPFYI--------------SL---------------IVdmastknsskpgggagnkyler 330  chicken
2_pfamImport   68 ---KFAFLRSPLTLIDLVAILPYYI--------------TL---------------LVdgaaagrrkp---gagnsyldk 112 
P97557        270 ---RCHFLRKVPNIIDLLAILPFYI--------------TLlveslsgshttqeleNV---------------------- 310  Norway rat
Q9BQ31        247 ---QKKFWKNPLNIIDFVSIIPFYA--------------TL---------------AVdtkeees----------edien 284  human
O35173        266 ---TRNFFCHPLNLIDIVSVLPFYL--------------TL---------------LAgaalgdqrg-----asgeelgd 308  house mouse
P17971        254 ---RCKFVRSVMSIIDVVAIMPYYI--------------GL---------------GItdn-----------------dd 284  fruit fly
P91784        265 ---RFRHARISLSIIDVIAILPFYI--------------GL---------------AMtkt------------------s 294  penicillate j...
O76266        277 ---KIMFWFGFQNLIDVTAVVPYYV--------------TL---------------FNvvstms-----------cstak 313  medicinal leech
Q25150        222 -IPGMAALRAFRVLRALKAISAIPGLKAIVAALIESVKALKDVMILTLFCLSVFALIGLQLFmGSLRnkcirqwppyvnd 300  Halocynthia r...
Q9XXD1        345 aFLVIRILRVLRVIRVLKLGRYSSGLQMFGKTLKASFRQLGMMAMVVMTGVIFFSTLVYFLE------------------ 406  Caenorhabditi...
O73606        331 vGLVLRFLRALRILYVMRLARHSLGLQTLGLTVRRCTREFGLLLLFLCVAMALFSPLV---------------------- 388  chicken
2_pfamImport  113 vGLVLRVLRALRILYVMRLARHSLGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIE------------------ 174 
P97557        311 -GRLVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGISIFSTIEYFAE------------------ 371  Norway rat
Q9BQ31        285 mGKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVE------------------ 346  human
O35173        309 lGKVVQVFRLMRIFRVLKLARHSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAE------------------ 370  house mouse
P17971        285 vSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLVFSLAMAIIIFATVM---F------------------ 343  fruit fly
P91784        295 iSGAFVSLRVFRVFRIFKFSRHSKGLRILGSTLTSCASELGFLLFSLSMAIIIFATVV---F------------------ 353  penicillate j...
O76266        314 sSASLAFLRVIRLVRVFKLTKHSTGLQVLILTIKASSEELGLFLVVLLVCMLVYSSAIYYAElGVPK------------- 380  medicinal leech
Q25150        301 elmtmwltqnytdfnhsnplvylgnltqvikpeisvakpmpcdpnpacnettiwfnqtwenwmenecnycfvrgaawlcg 380  Halocynthia r...
Q9XXD1            --------------------------------------------------------------------------------      Caenorhabditi...
O73606            --------------------------------------------------------------------------------      chicken
2_pfamImport      --------------------------------------------------------------------------------     
P97557            --------------------------------------------------------------------------------      Norway rat
Q9BQ31            --------------------------------------------------------------------------------      human
O35173            --------------------------------------------------------------------------------      house mouse
P17971            --------------------------------------------------------------------------------      fruit fly
P91784            --------------------------------------------------------------------------------      penicillate j...
O76266            --------------------------------------------------------------------------------      medicinal leech
Q25150        381 ngtdtgkcwegyecvLTGENPNFGYTS-FDNFSWAFLSLFRLMAQDYWENLYQLTLRANgkvyliFFMVVIFLGSFYLIN 459  Halocynthia r...
Q9XXD1        407 --------------------KDEPASK-FHSIPAACWWCIVTMTTVGYGDLTPVTVPGK------LVATGAIACGVLVLA 459  Caenorhabditi...
O73606        389 ---------------YLAESELGAKQE-FTSIPTSYWWAVISMTTVGYGDMVPRSIPGQ------VVALSSILSGILLMA 446  chicken
2_pfamImport  175 -------------------NEMADSPE-FTSIPACYWWAVITMTTVGYGDMVPRSTPGQ------VVALSSILSGILLMA 228 
P97557        372 --------------------QSIPDTT-FTSVPCAWWWATTSMTTVGYGDIRPDTTTGK------IVAFMCILSGILVLA 424  Norway rat
Q9BQ31        347 ---------------------KDDHTSsLTSIPICWWWATISMTTVGYGDTHPVTLAGK------LIASTCIICGILVVA 399  human
O35173        371 ----------------EENEG-------FHTIPACWWWGTVSMTTVGYGDVVPETVGGK------LAASGCILGGILVVA 421  house mouse
P17971        344 -----------------YAEKNVNGTN-FTSIPAAFWYTIVTMTTLGYGDMVPETIAGK------IVGGVCSLSGVLVIA 399  fruit fly
P91784        354 -----------------YVEKDVNDSD-FTSIPASFWYTIVTMTTLGYGDMVPKTIPGK------LVGSICSLSGVLVIA 409  penicillate j...
O76266        381 -------------------------SN-IHSIPDAFWWAIITMTTVGYGDTFPVGPFGK------VIGAACAISGVLTLA 428  medicinal leech
Q25150        460 LILAVVAMAYEEQHQLVA 477  Halocynthia roretzi
Q9XXD1        460 LPITIIVDNFMKVAETER 477  Caenorhabditis elegans
O73606        447 FPVTSIFHTFSRSYSELK 464  chicken
2_pfamImport  229 FPVTSIFHTFSRSYLELK 246 
P97557        425 LPIAIINDRFSACYFTLK 442  Norway rat
Q9BQ31        400 LPITIIFNKFSKYYQKQK 417  human
O35173        422 LPITIIFNKFSHFYRRQK 439  house mouse
P17971        400 LPVPVIVSNFSRIYHQNQ 417  fruit fly
P91784        410 LPVPVIVSNFSRIYLQNQ 427  penicillate jellyfish
O76266        429 MPVPILTGHFNKFYAHKT 446  medicinal leech
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap