Conserved Protein Domain Family
Clusterin

?
pfam01093: Clusterin (this model, PSSM-Id:366460 is obsolete and has been replaced by 395869)
Clusterin
Statistics
?
PSSM-Id: 366460
View PSSM: pfam01093
Aligned: 51 rows
Threshold Bit Score: 447.381
Threshold Setting Gi: 620962901
Created: 24-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDL85369      29 ELQELSTQGSRYVNKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEGALDDTRDSEMKLKAFPEVCNETMMAL 108 Norway rat
Q95KN1        33 NLKGFSEAGDIDVDEEVKKALIGMKQMKIMMERREEEHTNLMKTLKKCKEEKQEALKLMNEVQEHLEEEESLCQVSLTDS 112 dog
XP_012657499  33 NLKSFSAAGETHVDEEVKKALMGIKQMKTVMEKKEEEHSNLMKTLKKCREEKQEALKLMNEVQEHLAKEERLCHVSLAES 112 small-eared galago
7_pfamImport   1 NLKSFSEVGEIEADEEVKKALIGIKQMKIMMERKEKEHRNLMSTLKKCREEKQEALKLLNEVQEHLEEEEKLCQVSLADS 80 
Q15846        33 NLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADS 112 human
XP_008259348  33 NLKSFSEAGEIDEDEAVKMALIGIKQMKIMMERREEEHTKLMKTLKKCREEKQEALKLMNEVQDHLEEEERLCQVSSADS 112 rabbit
XP_021584577  83 NLKSFSEAGETDGDGEVKKALIGIKQMKLMMERREEEHTKLMTTLKKCKEEKQGAVKLMNEVQEHLEEEERLCQASLADS 162 thirteen-lined ...
XP_013012573  43 NANSFSEAGEIDVDGEVKIALIGIKQMKIMMERREEEHSKLMKTLKKCKEEKQEALKLMNEVHEHLEEEESLCQVSLADS 122 domestic guinea...
XP_001493067  33 HLKGFSDAGEIDVDEEVKKALIGMKQMKIMMERREEEHTHLMKTLKKCREEKQEALELMNEVQEHLEEEERLCQASLTES 112 horse
XP_023599334  33 sPKGFSEPGDTDVGEEVKKALIGMKQMKTMMERREEEHTNLMTTLKKCRVEKQEALKLMNEVQEHLEEEERLCQESLTDS 112 little brown bat
EDL85369     109 WEECKPCLKHTCMKFYArVCRSGSGLVGRQLEEFLNQSS--PFYFWMNGDRIDSLL--ESDRQQSQVLDAMQDSFTRASG 184 Norway rat
Q95KN1       113 WDECKSCLESNCMRFHT-TCQPSWSSMKNTVEQFFRNIY--QYLFPFDEDNEKDLPvgEKFIEEDAQVAQIENVFNQLTV 189 dog
XP_012657499 113 WDECRSCLESDCMRFYT-NCQPSRSSVKNTIGQFFRKIY--QGLFPFREDDETDLPisEKFPEEDSQLTHMEDVFSQLAV 189 small-eared galago
7_pfamImport  81 WDECKSCLENNCMRIHT-TCQPSWSSVKNKVRHLFQLTFllVYAFCFLESNTNGCPlsRG-IAEVADLNRMSSAPLKAPI 158
Q15846       113 WGECRSCLENNCMRIYT-TCQPSWSSVKNKIERFFRKIY--QFLFPFHEDNEKDLPisEKLIEEDAQLTQMEDVFSQLTV 189 human
XP_008259348 113 WDECRSCLESDCMRFYT-TCQPRWSSVKNTIEQFFRKIY--QFLFPFHEDNEKDLSasEKYIEEDEQLVQIEGVFSQLSV 189 rabbit
XP_021584577 163 WEECRTCLDSNCMRFYS-TCQPGWSSVKNTVEQFFRKIY--QFLFPLHHDEHSHLPssEQHTQEDAQVTHMEKAFLQLTA 239 thirteen-lined ...
XP_013012573 123 WDECRACLESNCMRFDT-TCQPAWSSVKNMVEQFFRKIY--QFLFPLQENDRSG-PvsKGVTEEDAQVSHIEHVFSQLSA 198 domestic guinea...
XP_001493067 113 WGKCKSCLESSCLRFYT-ACQPRWTSMKNTVEQFFRKIY--QFLFPFHEDNEQDLPvgEKVIEEDAQLTQIENVFSQLTV 189 horse
XP_023599334 113 WDECKSCLQSDCVRFYT-THQPSWSSMGNVIGQFFRKIY--QFLFPLHEEKEKELPvaEKVLEEDAQVTQIEHMFSQLTV 189 little brown bat
EDL85369     185 IIDTLFQDRFFTHEPQDIHHFSPMGFPHKRPHFLY-------------PKSRLVRSLmplshygplSFHNMFQ----PFF 247 Norway rat
Q95KN1       190 DVRFLFNRSLNVFKQMQQEFDQTFQSYFMSDTDLMqpnflpalskeprKKADPVQSW---------DIPSFFQ----LFY 256 dog
XP_012657499 190 DVKSLFNRSLNVFKQMQQEFDQAFQSYFMSDTDFIessfspalskeptKKEDFVQNW---------ALPNFFQ----LFC 256 small-eared galago
7_pfamImport 159 RMKNQVNGSWYRERQTIHPKNLTFLGHQWAMHALRnfrffpsfiqmtlNREGLDQCW---------G-PVFSQifdpLFI 228
Q15846       190 DVNSLFNRSFNVFRQMQQEFDQTFQSHFISDTDLTepyffpafskepmTKADLEQCW---------DIPNFFQ----LFC 256 human
XP_008259348 190 DVKSLFNRSVSVFKQMQQEFDEAFQLYFMSDTDLIepyffpalskepmQKAGLVQNW---------NIPDFFQ----MFR 256 rabbit
XP_021584577 240 TAESLFNRSLSVFKQMQQEFDQAFQSDFMSETNLMephlfpalskeptEKADLGQSW---------DIPNFFQ----LFC 306 thirteen-lined ...
XP_013012573 199 DVTSLFNRSLYVFKQLRREFDQAFQSYFTSGTDVTepfffpslskepaYRADAEPSW---------AIPNVFQ----LLC 265 domestic guinea...
XP_001493067 190 DVRFLYNRSFNVFKQMQQEFDQAFQSYFMSDTDLIepyffpalskeptKKSNLVQSW---------DIPSFFQ----LFC 256 horse
XP_023599334 190 DVRCLFNRSFNVFKQMEREFDQAFRSYFMSDTDVIepyvfpalfkeptKKADLVQSW---------DGPGLFQ----LFC 256 little brown bat
EDL85369     248 DMIHQAQ----------QAMDVQLHSPal---------------qfPDVDFLKEGEDD-RTVCKEIRHNSTGCLKMKGQC 301 Norway rat
Q95KN1       257 NFSLSIY----------HSISTTITKTlnaiedlp----kqdndsnHGSLSSKTLPVQhRGPYGEFGQNLSECFQFHARC 322 dog
XP_012657499 257 NFSLSIY----------ESVSETITEAlnaiedlp----eqdkgpdQGHL---MLPAQdRRLCGELGQNSSECFKFHERC 319 small-eared galago
7_pfamImport 229 TINTSAYshththkalvRKISDIVSSSlka--------------pdNGGLISKMVPGQdRGLCGELGQNLSGCFKFHEKC 294
Q15846       257 NFSVSIY----------ESVSETITKMlkaiedlp----kqdkapdHGGLISKMLPGQdRGLCGELDQNLSRCFKFHEKC 322 human
XP_008259348 257 NFSVSIY----------ESVSGAITETltavqdsp----kqgkdpgHGRLASKMLPEQdRQPCGELSQDLSGCFRFHQRC 322 rabbit
XP_021584577 307 NFSRSIY----------ESLREAVTHTlraiedspkhdegsdqgtqQGGLISKTLSEQdKGPCAELGQNFSGCFRLQEKC 376 thirteen-lined ...
XP_013012573 266 NLSFSVY----------QSVSEKLITTlratedpp----kqdkdsnQGGPISKILPEQdRGSDGKLGQNLSDCVNFRKRC 331 domestic guinea...
XP_001493067 257 NFSVSIY----------QSVSATITETlnaiedfp----kqdkdsdRGGPSSKMLPVGdRGLCGDLGQNLSECFQFHARC 322 horse
XP_023599334 257 DFSLSIY----------RSLSTTVTETlnamedr-----pkhqdadPGGLSSKTVPVWnRGPCGELGQNSSECFHCHARC 321 little brown bat
EDL85369     302 EKCQEILSVDCstnnPAQANLRQELNDSLQVAERLTQQYNELLHSLQSKMLNTSSLLEQLNDQFSWVSQLANLTQGDDQ- 380 Norway rat
Q95KN1       323 QKCQDYLWEDC----PDVPELHTKVDEALELVNISHQQYAQVLQMTQHHLEDTTYLMEKMREEFGWVADLANQAPGAENi 398 dog
XP_012657499 320 QKCQDYLSEDC----PDVPELHAELDEALRLVNVSSQQYTEVLRMTQQHLEDTSYLMERMRWQFGWVSELANQIPETEIi 395 small-eared galago
7_pfamImport 295 QKCQAHLSEDC----PHIPDLHTELDEAIRLVNISNQQYGQILQVTRKHLEDTAYLVEKMRGQFGWVSELADQTPETEIi 370
Q15846       323 QKCQAHLSEDC----PDVPALHTELDEAIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAPETEIi 398 human
XP_008259348 323 QKCQDYLAKDC----PNVPELHTELEEALKLVNVSNEQYAQILRMAQYHVEDTMYLMEKMRAQFSWVSDLANQTTPTENa 398 rabbit
XP_021584577 377 QKCQDYLSEDC----PDVADLHIELDKALRLVNVSNEQYDQVVQMIQHHLEDTMDLMERMSQQFGWVSELANQSLGAENi 452 thirteen-lined ...
XP_013012573 332 QKCQDYLSDDC----PNVPELYRELNEALRLVSRSNQQYDQVVQMTQYHLEDTTLLMEKMREQFGWVSELAYQSPGAEDi 407 domestic guinea...
XP_001493067 323 QKCQDYLWEDC----PDVPELHSKVDEALKLVNISNQQYTQVLQMTQQHLDDTAYLMERMREQFGWVTELANQTPGTENi 398 horse
XP_023599334 322 QKCQDYLWEDC----PDVPELHTEVDEALKLVNISDQQYVQILQVTQHHLEDTAYLMEKMREEFGWVAELANQTLGTENt 397 little brown bat
EDL85369     381 YlRVSTVTTHSSDSEvPS--RVT-EVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRK 443 Norway rat
Q95KN1       399 F-DSTKMVPNIHEGN-FSkqDET-MIDLSILSSPNFTLKIPLEESAETSNFISYMLEKAVQHFKKH 461 dog
XP_012657499 396 F-NSIKVVPSVREDN-FSkqNET-----SILPSSNFTLKSPLEESAESSNVIGYLVAKALLHIKKH 454 small-eared galago
7_pfamImport 371 F-NSIQAVPRFHEGS-ISkqDETmMTDVSILPSSNFTLKIPLEESAESSTFIGYVVAKALQHFKEH 434
Q15846       399 F-NSIQVVPRIHEGN-ISkqDETmMTDLSILPSSNFTLKIPLEESAESSNFIGYVVAKALQHFKEH 462 human
XP_008259348 399 F-NSTKEDPSVRERT-STrqGEM-KVDFSILPSPNSTLKMLLEESSESSSFVDYIAAKVRQHFKEH 461 rabbit
XP_021584577 453 F-NSIKAVPRAHEGN-SSkqDDP-VVESSILPSPKSALGIPLEESAESSNFIDYVVTKVLQHLKEr 515 thirteen-lined ground squirrel
XP_013012573 408 F-NPVKVALSAHEGN-SSdqDDT-VVPSSLLPSSNFTLSSPLEKSAGNANFIDHVVEKVLQHFKEH 470 domestic guinea pig
XP_001493067 399 F-NSIEVIPGVPEGN-FSkrGDM-TIDFNILPSPNVTLKIPLEESAENSNFLSHVLAKAVQHFKEH 461 horse
XP_023599334 398 F-SSRKVVPDVHQGN-ISkqDET-MIDLSILPSPNVTLKIPLEESSESSNFVSYVLEKAVQHLKEH 460 little brown bat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap