2JP3,2JO1


Conserved Protein Domain Family
ATP1G1_PLM_MAT8

?
pfam02038: ATP1G1_PLM_MAT8 (this model, PSSM-Id:366888 is obsolete and has been replaced by 396568)
Click on image for an interactive view with Cn3D
ATP1G1/PLM/MAT8 family
Statistics
?
PSSM-Id: 366888
View PSSM: pfam02038
Aligned: 30 rows
Threshold Bit Score: 51.409
Threshold Setting Gi: 169404534
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JP3_A         5 DKGSPFYYDWESLQLGGLIFGGLLCIAGIALALSGKCKc-RRNHTPS 50  Norway rat
EHB14010     145 EEFDPFFYDYATVQTVGLTLATIMFLLGIIIIISKKVKcrKADSRSE 191 naked mole-rat
Q04679        14 GTENPFEYDYETVRKGGLIFAGLAFVVGLLILLSKRFRc-GGSKKHR 59  Norway rat
P54710        14 GDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRc-GGNKKRR 59  human
5_pfamImport   1 EEMERFHYDYDAVRNGGLIFAGLAFIVGLIIILSKKFRc-GGRKKRR 46 
XP_016289311  14 GDEDRFQYDYSTVRNGGLIFAGLAFIVGLMIILGKRLRc-GGKKKRR 59  gray short-tailed opossum
XP_014596772  45 GDVDPFYYDYETVRNGGLIFAALAFLVGLLILLGKRLRc-GAKKQHR 90  horse
XP_025122616 127 ENEDPFYYDYETVRNGGLIFAALAFIVGLVIILSKRFRc-GAKKKHR 172 water buffalo
XP_008967459  13 EEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKcrKADSSPT 59  pygmy chimpanzee
XP_017359655 172 HEDDPFFYDEHTLRKRGLLVAAVLFITGIIILTSGKCR--QLSQLCR 216 Cebus capucinus imitator
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap