5C16


Conserved Protein Domain Family
Myotub-related

?
pfam06602: Myotub-related (this model, PSSM-Id:368997 is obsolete and has been replaced by 399535)
Click on image for an interactive view with Cn3D
Myotubularin-like phosphatase domain
This family represents the phosphatase domain within eukaryotic myotubularin-related proteins. Myotubularin is a dual-specific lipid phosphatase that dephosphorylates phosphatidylinositol 3-phosphate and phosphatidylinositol (3,5)-bi-phosphate. Mutations in gene encoding myotubularin-related proteins have been associated with disease.
Statistics
?
PSSM-Id: 368997
View PSSM: pfam06602
Aligned: 226 rows
Threshold Bit Score: 243.916
Threshold Setting Gi: 190586525
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5C16_A       119 LFAFSYKek-------fpINGWKVYDPVSEYK-RQ-----------GLP-Ne----------------sWKIS-KINSNY 161 human
EDV26578     167 llprrsqansvsyeelkkmlryligckhtEFYtKYansmeglaktgGVPsYrkisdyeseldhlktpkiWCINeDANRGF 246 Trichoplax adha...
XP_417799    113 MYPFFHRpqs-----lrlEEGWPLLPVEQYFQ-QL-----------ALqt-----------------tqWRLS-DVNRDF 157 chicken
XP_003228769 109 MYPFFYRpqsm----rlaGGGRQPHALEKYYQ-QVasr----------------------------tgaWRLS-VVNEDF 154 green anole
XP_005317803 109 SFPFFYRpkg-----lrlGDAWHFHPPECYYK-RV-----------Aret-----------------naWRLS-EVNQDF 153 thirteen-lined ...
XP_018652960  68 LYPFAYKsnqssllpvikTTDWPnninel-----------------------------------lsvgsWRIS-QLNENY 111 Schistosoma man...
XP_007492944 108 SYPFFFRpqs-----lrlGDAEDLYPPDHFYQ-QVale----------------------------tdaWRLS-TVNRDF 152 gray short-tail...
XP_007669961  51 SYPFFYRpqt-----mklEDGWRLYPYDLYYQ-RVsre----------------------------tdaWRLS-TVNADF 95  platypus
XP_016159212 108 MYPFFYRpas-----lrlQQGWHRFTLESFFQ-QLssq----------------------------tsqWRPP-PPPRDF 152 collared flycat...
XP_017946599 132 SYPFFFRppg-----yslGHGWPRDTMENFYH-KMrae----------------------------tddWRLS-EVNLDF 176 tropical clawed...
5C16_A       162 EFCDTYPAIIVVPTSVKDD--DL-SKVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGP-------------------- 218 human
EDV26578     247 K-YQSLPEILLCPNDAVSKklDLnMLLAAYREK-RYPVPCWYYQTNDVYLLRSASEDHGLrencnemegrifgiikdpnk 324 Trichoplax adha...
XP_417799    158 AVCPTYPPAVIVPAAVSEE--TL-RRAARFRQGGRFPVLSYYHSRNGTVMLRSGQPLTGP-------------------- 214 chicken
XP_003228769 155 QACPSYPALVVVPSSVDDA--AL-RKSARFRQGGRFPVLSYYHKKNGTVMLRSSQPLVGP-------------------- 211 green anole
XP_005317803 154 SLCPSYPRAVIVPRAVDDD--AL-ARSARFRQGGRFPVLCYHHAPSGTVLLRSSQPLTGP-------------------- 210 thirteen-lined ...
XP_018652960 112 SLCNSYPKTFIVPVKCDDQ--MI-IESSRFRHGGRFPLLLYYHKPRQTTLLITAEPLINQstitnnqnttpllssnsslt 188 Schistosoma man...
XP_007492944 153 QVCASYPPALVVPRGIGDE--VL-ARSAHFRQGGRFPVLSYYHSTNGTVMLRSSQPLQGA-------------------- 209 gray short-tail...
XP_007669961  96 RVCASYPPSVIVPSGVEDE--AL-VRSARFRQGGRFPVLCYYHGRTGTAMLRSSQPLVGA-------------------- 152 platypus
XP_016159212 153 SACPSYPPAVIVPAAVGDD--TV-AKAARFRQGGRFPVLSYFHPKNGTalLRSSQPLTGP-------------------- 209 collared flycat...
XP_017946599 177 KICPSYPAKVIVPRICSDE--TL-QKAAAFRQAGRFPVLSYYHSANQTALLRSAQPLFGT-------------------- 233 tropical clawed...
5C16_A       219 -------------------------NDKRCKEDEKYLQT-IMD-AnaqsHKLIIFDARQNsVADTNKTKGGGYESESAYP 271 human
EDV26578     325 ------qkpfktielanrfpnylatVWQRIYTDNGIVRVg---------------------NVIQPKELSSGYNNLKY-- 375 Trichoplax adha...
XP_417799    215 -------------------------NRKRCAEDEMLLGS-VLDdG----ERGFIIDTRSAqAAKQARMTGGGTEPKSSYP 264 chicken
XP_003228769 212 -------------------------HRKRCPEDEGLLAAaLDG-R----SRGFVLDTRSAqAAKQAKMMGGGTEHRSAYA 261 green anole
XP_005317803 211 -------------------------QKRRCAEDEDLLRA-VLAgah-pgARGFIVDTRSAqAAKQARMTGGGTEAKAAYP 263 thirteen-lined ...
XP_018652960 189 sstksnnliinsssknsilpfsstfNTGRCRSDEQLLSCiLPD-K----CRGVILDLRTQnETKKPQATSGLVEFEQYYP 263 Schistosoma man...
XP_007492944 210 -------------------------NRRRCAEDEELLRAaLALgG----QRGLVLDTRSAqAVKQARITGGGTEAKAAYP 260 gray short-tail...
XP_007669961 153 -------------------------NRRRCREDEELLGAvLGG-H----RRGYVLDTRSTqAAKQARVTGGGTEAKSCYL 202 platypus
XP_016159212 210 -------------------------NRRRCREDEKLLGTiLDE-G----ERGFIIDTRSAqAAKQARMSGGGTEPKSCYP 259 collared flycat...
XP_017946599 234 -------------------------APHHCKHDEALLNAaLME-Q----SSGFIIDTRSAqEAKQARNEGGGTESKSRYR 283 tropical clawed...
5C16_A       272 NAELVFLEIHNIHVMRESLRKLKE-IVYPs-iDEARWLSNVDG-----THWLEYIRMLLAGAVRIA---DKIESGKT--- 338 human
EDV26578     376 ------------HCLKGSDRKYWN--------SDKDWFASLAA-----TQWPNFIRVCLFIATKIA---DKLHYGAV--- 424 Trichoplax adha...
XP_417799    265 qWKRLHRPLERGRPLQESFIKLVE-ACNDaslGMDRWLGRLES-----CRWLSHVKAALSTACLAA---QCLDREES--- 332 chicken
XP_003228769 262 GWKRMHRALDRGRPLQESFVKVVE-TCNDpslTMDRWLSKLEA-----SKWLTHVKESLGTACLAA---QCMEREEA--- 329 green anole
XP_005317803 264 gWKRLHRPLERGRALQESFVRLVE-ACGDpeqSMDRWLSRLEG-----CRWLAHVKEALSTACLAA---QGMEREGA--- 331 thirteen-lined ...
XP_018652960 264 QWRRVCRPLESTGNLIVTFRKFIYaAVAGa--------TALDAldafaQQQLQQEQCLLAEKQRRAskdQSLEEAKLrgs 335 Schistosoma man...
XP_007492944 261 GWKRLHRPLERGRPLQDSFVRLVE-ACTDpslSMDRWLSRLDG-----CRWLTHVKEALTTACLVA---QGMDREGV--- 328 gray short-tail...
XP_007669961 203 GWKRLHRPLERGRPLQDSFTKLVE-SCNDpslSMDRWLSRLEA-----SKWLAHVKEALGTACLAA---QGMDREGA--- 270 platypus
XP_016159212 260 QWRRLHRALDRGRPLQESFIRLVE-ACSDpslSMDRWLARLDS-----SRWLGHVKAALSTACLAA---QCLDREDC--- 327 collared flycat...
XP_017946599 284 NWRVLHRPLERGHALQDSLVRLVV-TCYDpsiGMTRWLSKLQA-----ARWLSHVKEALSTAGLIA---ECIERECA--- 351 tropical clawed...
5C16_A       339 SVVVHSSDGWDRTAQLTSLAMLMLDSYYRTIKGFETLVEKEWISFGHRFALRVGhgn-dnhADAD--RSPIFLQFVDCVW 415 human
EDV26578     425 SILVKDYDGAELSCVICSLVQVILDGDCRTIKGFQTLLQKNWVVVGYRFNASQ--------------ESPFFELFLSCIS 490 Trichoplax adha...
XP_417799    333 SVLVHGAEGTDTTLLVTALAQLILEPGCRTLKGFQGLLEREWIQAGHPFHLRCAhsaysharLKQ--EAPLFLLFLDCVW 410 chicken
XP_003228769 330 CVLVHGAEGMDTTLLVTALAQVILDPCRRTMAGFQELLEQEWIQAGHPFHLRCArsa--ysHARLkqESPVFLLFLDCVW 407 green anole
XP_005317803 332 CILVHGAEGRDSTLLVTSLAQLILDPLSRTITGFQELVEREWIQAGHPFQLRCAhsafsharPKH--EAPTFLLFLDCVW 409 thirteen-lined ...
XP_018652960 336 CVIVQSRKGTDRAILVASLIQIILNPESRTIQGFQTLIDQTWLNAGHPFSDRCRnsafsikPPKD--ESPVFILFLDCVW 413 Schistosoma man...
XP_007492944 329 CFLVHGAEGTDATLLVTSLAQLILDPKCRTMHGFQSLLEREWIQAGHPFQQRCAhsa--yaQGRPkhEAPTFLLFLDCVW 406 gray short-tail...
XP_007669961 271 CILVHGPEGTDTTLLVTALAQVILDPDCRTLRGFQALLEREWIQAGHPFQLRCArsa--ysHARPkhEAPTFLLFLDCVW 348 platypus
XP_016159212 328 KVLVHGAEGTDTTLLVTALAQLILDPSCRSLEGFQALLQREWIEAGHPFHLRCArsa--asHGRGkqEAPLFLLFLDCVW 405 collared flycat...
XP_017946599 352 NVLVHGEDGTDNTLLLTSLAQLILCPESRTMDGFQDLIEREWLQAGHPFQLRCAqsg--wsQSRAqqESPHFLLFLDCCW 429 tropical clawed...
5C16_A       416 QMTRQFPSAFEFNELFLITILDHLYSCLFGTFLCNCEQQR 455 human
EDV26578     491 QLLYQNPLAFEFSPNYISHLLDISLCGLTETFSYNNEYER 530 Trichoplax adhaerens
XP_417799    411 QLSRQFPFSLEFSEGLLLTLFDNAYASDYGTFLCNNEKER 450 chicken
XP_003228769 408 QLGRQFPLSLEFNEAFLLALFEHSYASPYGTFLCNNEKER 447 green anole
XP_005317803 410 QLGRQFPLSLEFGEGLLLALFEHAYASPFGTFLCNSEKER 449 thirteen-lined ground squirrel
XP_018652960 414 QLLRQYPNSFEFTDELLCIIAKHAYFSEYGTFLGNSLQER 453 Schistosoma mansoni
XP_007492944 407 QLSRQFPLSLEFGEGMLLALFEHAYASPFGTFLCNSEKER 446 gray short-tailed opossum
XP_007669961 349 QLSRQFPLALEFGEGLLLTLFEHAYASPYGSFLCNSEKER 388 platypus
XP_016159212 406 QLSRQFPFSLEFGEQLLLTLFDNAYASSFGTFLCSSEKER 445 collared flycatcher
XP_017946599 430 QLGRQFPRALEFNERFLCTLATHAYSSEYGSFLCNNEKER 469 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap