Conserved Protein Domain Family
SR-25

?
pfam10500: SR-25 (this model, PSSM-Id:371095 is obsolete and has been replaced by 402225)
Nuclear RNA-splicing-associated protein
SR-25, otherwise known as ADP-ribosylation factor-like factor 6-interacting protein 4, is expressed in virtually all tissues. At the N-terminus there is a repeat of serine-arginine (SR repeat), and towards the middle of the protein there are clusters of both serines and of basic amino acids. The presence of many nuclear localization signals strongly implies that this is a nuclear protein that may contribute to RNA splicing. SR-25 is also implicated, along with heat-shock-protein-27, as a mediator in the Rac1 (GTPase ras-related C3 botulinum toxin substrate 1) signalling pathway.
Statistics
?
PSSM-Id: 371095
Aligned: 17 rows
Threshold Bit Score: 135.403
Threshold Setting Gi: 551486893
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ELK26307       9 RSRSRSRSR---------GRGSEKRRKKSSKDArGSCSASRSHGR------------KASTTSsg--aeERSKHQARRRR 65  Myotis davidii
XP_005989016   5 RSRERSRSRtktsscgkgLKRDGKKRSRSSSSSrRSTSLSKKCHH------------STSPSK------ERKPEKKKAKR 66  coelacanth
Q5F4A9         9 RSRSSSRSPs--------GSGREKGGARSS-------AASPGPRH------------RLSSAAar--egRKKEGRKKKKR 59  chicken
Q502P0         5 DSDSRSRSR---------NREENKSRSLSSSSA---RRPSPNHEK------------KH----------EHSSEKKKMKR 50  zebrafish
XP_001521084  11 RSRSGSRGRp--------ERSKEMRRKRGSKERrRSRSASGSRSR------------RPRAAShk---pERSKDRGRKRR 67  platypus
XP_003761099  41 RSRSRSGSHgp------pEHGERRRRRRSSKDMgRSPSASGSQGQ------------RISLGSng---eERSRDKARKRR 99  Tasmanian devil
XP_005795026   1 mnRTRSSDRdt-----reKKTEKKKRGRSSSSS-SSSSSSSSRSR------------SAKKISstkkkmTDGKEQRKRRR 62  southern platyfish
XP_003975005   1 mNRSSSHDRsi-----reNKTEPKKRRRSSSSS--SSSSSSSRSRsksskksshknkDV---------------KTKKKR 58  torafugu
XP_014730407   1 -----mahsrsrkrsrsrsksnsrsrherkekkrrksskdsqrgssspprkrisgshghksslatareekkkegkdkkkr 75  common starling
XP_007239762   5 RSRSRSRERkstsrqgreRRTEKKRRKYSSSSS-SSSSASPSSQK------------KHGRVSnksmskDRKTERKKQKR 71  Mexican tetra
ELK26307      66 R-SSSSSSSSSSSSSSSSSSSSSSSSHG-------RKKSGKYKDKKRKKKKK-----RRRKKLKKKGK---E---KAEAR 126 Myotis davidii
XP_005989016  67 KpSASTSSDSSSPASSTSTCSSSLSDSDtes-kesKQQKGKNKTKKSKKKSKkm-nrKSKKMKKKKAK---Ea-pTAAKP 140 coelacanth
Q5F4A9        60 KaKASSSDRSSSSRSSSSSSSTSSSDSDtrakqhsRRKRGKHKDKKKKKKMK--------KKLKKKSK---Er-vKEERG 127 chicken
Q502P0        51 RrSSSSSSSSSSPSPS-------------------REKKAKKKKKRREAKKLkr-ekKKEKKEKKRQKklaLk-aERAAA 109 zebrafish
XP_001521084  68 RpSSSSSSTSSSSSSSSSSSSSSRSSSGg------RKKRSKRKDKKRRKKKKk----KAKKKVKKKCR---Ek-gEAGTQ 133 platypus
XP_003761099 100 RpRSSSSSSSSSSSSSSSSSTSSSSSSGass--ggRKKRGKRKDKKSTKKKAkkklrKKKKKKKKKEE---Ka-aKAKAK 173 Tasmanian devil
XP_005795026  63 TrSSSSSSTSSSSSPSSSSSSd------------eKRKRKKSKAKKKKLKKQkaklkKQRKKEKKKLKkkeKk-lKKEVE 129 southern platyfish
XP_003975005  59 RrSSSSSSTSSSSSSSSSS----------------NEKTKRKKSKKSKAKKKkaklkKQNKKEKKKKQklkKk-tKAAAA 121 torafugu
XP_014730407  76 kastsssgnssstsssssssssssssddssdsdskmkksqdskkkrmkqkdkkkrkkqkkkikkkskkktkEr-aKEEKA 154 common starling
XP_007239762  72 RrSSSSSSSSSSSSSSSS---ISSSSSTsss-deeAKKKKKHRMTKKRLKKMkakkkKKEKKEKKRLKkikKlaaKAEKV 147 Mexican tetra
ELK26307     127 PPEA-----LPGPS--------L----------------DQWHR----PAGEEeDGPVLTDEQKSRIQAMKPMTREEWDA 173 Myotis davidii
XP_005989016 141 KLSK-----MAGPS--------V----------------EQWQR----ETWVE-SGPVLTDEQKSRIQAMKPMTKEEWDA 186 coelacanth
Q5F4A9       128 VSEA-----LPGPS--------L----------------ELWQK----EPLAD-SGPVLTDEQKSRIQAMKPMTKEEWDA 173 chicken
Q502P0       110 LTAS-----VPAPVpeekpqtyL----------------KTWQS----EETKE-HGPAMTDEQKAKLSTRRPLTKEEYEA 163 zebrafish
XP_001521084 134 SPQG-----MPGPS--------L----------------DQWQK----EPLEE-SGPVLTDEQKSRIQAMKPMTKEEWDA 179 platypus
XP_003761099 174 AVEE-----MPGPS--------L----------------DQWRK----EPPVE-SGPVLTDEQKSRIQAMKPMTKEEWDA 219 Tasmanian devil
XP_005795026 130 AMQR-----PPekp-----psyL----------------EVMQNeeeeEDEVE-LGPVMTDEQKARLATKRPLTKEEYEA 182 southern platyfish
XP_003975005 122 AAAAaaaa-----------avaVlpslpspaavkppsypELWQS-----DEVE-LGPVMTDEQKARLSTKRPLTKEEYEA 184 torafugu
XP_014730407 155 KGEE-----VPGPS--------L----------------EQWQK----ESGVD-PGPVLTDEQKSRIQAMKPMTKEEWDA 200 common starling
XP_007239762 148 ATKApliipVPGSVqvektqsyL----------------ETWQN----DDAAE-HGPVMTDEQKASFSTKRPMTKEEYEA 206 Mexican tetra
ELK26307     174 RQSVIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDGLAFQMRAG 228 Myotis davidii
XP_005989016 187 RQSVIRRVVDPETRRTRLVKGDGEILEEIVSRERHKEINRQATVGDGVSFQTRMG 241 coelacanth
Q5F4A9       174 RQSVIRRVVDPETGRTRLIKGDGEVLEEIVSKERHKEINKQATRGDGLAFQVRTG 228 chicken
Q502P0       164 RQSVIRRVLDPETGRTRLIRGDGEILEEIVSKERHKDINKQSTRGDGDAFQKRLG 218 zebrafish
XP_001521084 180 RQSVVRKVVDPETGRTRLIKGDGEILEEIVTKERHKEINKQATRGDGLAFQLRAG 234 platypus
XP_003761099 220 RQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHKEINKQATRGDGLTFQLRAG 274 Tasmanian devil
XP_005795026 183 RQSVIRRVVDPETGRTRLVRGEGEIIEEIVTREKHKEINKQTTMGDGNAFQRKLG 237 southern platyfish
XP_003975005 185 RQSVIRRVVDPETGRTRLIRGEGEIIEEIVSREQHKDINKQATKGDGNTFQKKLG 239 torafugu
XP_014730407 201 RQSVIRRVVDPETGRTRLIKGDGEVLEEIVSKERHKEINKQATRGDGLAFQVRTG 255 common starling
XP_007239762 207 RQSVIRRVTDPETGRTRLIRGDGEVLEEIVSKERHKDINKQSTKADGTTFQKRLG 261 Mexican tetra
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap