Conserved Protein Domain Family
RAD51_interact

?
pfam15696: RAD51_interact (this model, PSSM-Id:374028 is obsolete and has been replaced by 406187)
RAD51 interacting motif
This motif interacts with RAD51.
Statistics
?
PSSM-Id: 374028
Aligned: 21 rows
Threshold Bit Score: 49.9768
Threshold Setting Gi: 565300100
Created: 26-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ETE58018        8 GASGSKTSPLGRTPVRSPVHGLRLGLSRLAKVKPLHPPC 46   king cobra
XP_004007263 1114 AGSSFSYGISRVLPLKTCGRPIRIGLSRKAKLKQLHPYL 1152 sheep
Q1L8M2        306 GMVGRSPGASQNGSLKSPGQGLRLGLSRLARVKPLHPNV 344  zebrafish
XP_015147895  246 aatGASNNFMKCASVKSPTQCLRLGLSRLARVKPLHPNA 284  chicken
KFO65705       95 APSGSSNASVKCVPVKSPTHCLRLGLSRLARVKPLHPSA 133  American crow
EOB06393      213 AASGSTNNIGKYASVKSPTHGLRLGLSRLARVKPLHPSA 251  mallard
XP_002940349  280 APVGSVKHSLEGVTVKSPSQGLRLGLSRLARIKPLHPAi 318  tropical clawed frog
XP_026182537  285 GKSPTSSGP----AVKSPGQGLRLGLSRFVRVKPLHPSV 319  zig-zag eel
XP_006225792 1042 GGSHVSHGISRVQPLKTCSRPIRVGLSRRARLKQLHPYL 1080 Norway rat
XP_003734836 1106 RGSYFPHGISRVRPLKTCSRPIRIGLSRKARVKQLHPYL 1144 white-tufted-ear marmoset
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap