Conserved Protein Domain Family
DUF5401

?
pfam17380: DUF5401 
Family of unknown function (DUF5401)
This is a family of unknown function found in Chromadorea.
Statistics
?
PSSM-Id: 375164
Aligned: 3 rows
Threshold Bit Score: 892.939
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAP28691      205 VIFTSERCNRVTYGLRTVNGDPTRYKQCGPSGRVWIVPCAPQMTFDPEDRVCKERLDSRtAHKPMRKYETPpKTIITTPA 284  Caenorhabditi...
1_pfamImport    1 VIFTSERCNRVTYGLRTVNGDPSRYKQCGPSGRVWIVPCAPQMTFDPEDRVCKERADPK-VFKSMRKYELA-KNIITTPP 78  
P46504         22 VIFTSERCNRVTYGLRTVNGDPSRYKQCGPSGRVWIVPCAPQMTFDPEDRVCKERLDSR-IVKPMRKYETS-RTIITTPA 99   Caenorhabditi...
CAP28691      285 PIPSSYPVSAEVTPASAp---vAAPEEFVFSTIRPKSRKPKARTRGKLRKTTTVmsttpsttpmSMEIQKSSGEDEMTTT 361  Caenorhabditi...
1_pfamImport   79 PSYHPGSITAAASPPGA-----AAPEEFVFSTLRPKSRKPKTRTRTGKTRKTTT----------PMMVTTESSALIETTT 143 
P46504        100 PIPSSYPVSAEVIAPGApaashAAPEEFVFSTIRPKSRKPKAKTRGKFRKTTTAmiqt-----ttpMTVESFESMEMTTT 174  Caenorhabditi...
CAP28691      362 PRIVIFASKKNSLGGNKSEEMRNQn-QSVQRGRGVSAAFTRPGRIRtTTPMPVTHATRFVPGIQKITVA-PKENQGMPHT 439  Caenorhabditi...
1_pfamImport  144 PKIVIFASKKSASGGNRSGEQLKQ--QLIRDRAKNHSVFPRPGRPR-TTPTPVTHATRFVVGPQMSTVA-VKEVQGMPHT 219 
P46504        175 PKIVIFASKKNMNNTNRSGESRTQliRNRNRERGNAPAFTRPGRVRtTTPMSVTHATRFVPGIQHKVTVaPKEVQGMPHT 254  Caenorhabditi...
CAP28691      440 LAPYEKTERRGESFETG-ESMTTMTPEYTVRYNGQTMTENEFLNQLLHIVQHQKSVSERQQQDKFERMEQERIRQEKEEK 518  Caenorhabditi...
1_pfamImport  220 LPPYEKMERRKEIENLAtEDVTTMTPEYTVKYNGKTMTENEFLNQLLHIVQHQKAINERQQQEKFEKMEQERLRQEKEEL 299 
P46504        255 LAPYEKMDRRPDSFGV--EELTTMTPEYTVRYNGQTMTENEFLNQLLHIVQHQKTVSERQQQEKFEKMEQERLRQEKEEK 332  Caenorhabditi...
CAP28691      519 LREMERRRQLAEAEKARQAEIDRvswgvfatggnlnyfqQAAIYAEQERMAMERERELERIQQEERKREMERIRQEEIAM 598  Caenorhabditi...
1_pfamImport  300 AREVERRRKLEEAEKARQAAMEK----------------QAAIYAEHERLAMERERELDRIRQEDRKRELEQIRQQELAV 363 
P46504        333 ARELERRRKLEESETARQAELDR----------------QATIYAEQERMAMERNRELERIRLEEKKRENERVRQEEIAM 396  Caenorhabditi...
CAP28691      599 EISRMRELERLQMERQQKNERVRQELEAARKQKILEEERQRkikeqmremekIRKEQEEAREIEMRRLEEERAREMERVR 678  Caenorhabditi...
1_pfamImport  364 EMERMRELERLQMERQQKNERVRQELEAARKVKILEKERQR-----------VRAEQENARQREVQRLEEEREREMERVR 432 
P46504        397 EISKIRELERLQLERQRKNERVRQELEAARKYKLQEEERQRkiqqqkvemeqIR-QQEEARQEQLRVLEEERARELERVR 475  Caenorhabditi...
CAP28691      679 EEEMERQQQIERLRQQEEERKRKKleMEKEERKKALIEEERkRKVLEKELEERRQAILEEERKRKILEKEMEERQTAIYE 758  Caenorhabditi...
1_pfamImport  433 LEEQERQQQVERLRQDEAERRRKK--LEKEKEDRKRAEEQR-RKILEQELEARKRAMIEEERKRKLVEKEMEERQKAIAE 509 
P46504        476 QEELERQHQMEILRQQEEDQKKKKleKDREQREQQEAEELN-RMIIEKEMKENKQKMIEEKNKRKMLEKEMEDRQNAIYE 554  Caenorhabditi...
CAP28691      759 EQQRRKAEEERRKQKEMEERKQIQEQMRKVSEERSRLEAMERERELMRQIIENENKQQEFE-----ATTQITTIKPIYRP 833  Caenorhabditi...
1_pfamImport  510 EERRREAEEERRTEQEMEERRRIQEQMRKATEERSRLEAMEKEREMMRQIVESEKARAEYP-----VATPPTTIKPIYRP 584 
P46504        555 EEERRIAEEERRKQIEIEERRRIQQQIMIATEERSRLDAMEREREMLRQIKESEKQRKELErqellATTPITTIKPIYRP 634  Caenorhabditi...
CAP28691      834 N--ISEYQPPDVESHMIRFTTQSPEWATPSPATWNPSWNTVTAEEETPevslvmrsqCQINGECELKYDADSFCAHPGTP 911  Caenorhabditi...
1_pfamImport  585 RpvTSEYQPPDVESHMIRFTTQSPEWATPAPANWQPEWTEENAVHREP---------CDVNGECELKYDSDSFCVHPSNP 655 
P46504        635 D--ISEYRPPDVESHMIRFTTQSPEWATPSP-TWNPAWNTVTAEEETPgipi-ihsqCQVNGECELKYDVDSFCAHPRSP 710  Caenorhabditi...
CAP28691      912 SMYLQCAPLYGRLGRWTERHCPDTLIFIVSIGRCEKGEE 950  Caenorhabditis briggsae
1_pfamImport  656 SMYLQCAPLYGRLGRWTERHCPDTLIFLVRAGRCEKDDQ 694 
P46504        711 SMYLQCAPLYGRLGRWTERYCPDTLIFIVSIGRCEKGEE 749  Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap