3DU6,3DU6


Conserved Protein Domain Family
TERT_thumb

?
pfam17984: TERT_thumb 
Click on image for an interactive view with Cn3D
Telomerase reverse transcriptase thumb DNA binding domain
The catalytic subunit of telomerase is structurally similar to retroviral reverse transcriptases, viral RNA polymerases and, to a lesser extent, the bacteriophage B-family DNA polymerases. Like its structural homologs, the core catalytic subunit of telomerase, TERT, contains the fingers, palm and thumb domains required for nucleic acid and nucleotide associations as well as catalysis. The four major TERT domains: the RNA binding domain (TRBD); the fingers domain, implicated in nucleotide binding and processivity; the palm domain, which contains the active site of the enzyme; and the thumb domain, implicated in DNA binding and processivity are organized into a ring configuration similar to that observed for the substrate-free enzyme. This is the thumb domain found in Tribolium castaneum telomerase catalytic subunit, TERT. Contacts between TERT and the DNA substrate are mostly mediated via backbone interactions with the thumb loop and helix. The thumb helix sits in the minor groove of the RNA-DNA heteroduplex, making extensive contacts with the phosphodiester backbone and the ribose groups of the RNA-DNA hybrid.
Statistics
?
PSSM-Id: 375466
View PSSM: pfam17984
Aligned: 2 rows
Threshold Bit Score: 382.879
Threshold Setting Gi: 197305144
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3DU6_B 406 KLPPNYEIRHKFKLWNFNNQISDDNPARFLQKAMDFPFICNSFTKFEFNTVFNDQRTVFANFYDAMICVAYKFDAAMMAL 485 red flour beetle
3DU6_B 406 KLPPNYEIRHKFKLWNFNNQISDDNPARFLQKAMDFPFICNSFTKFEFNTVFNDQRTVFANFYDAMICVAYKFDAAMMAL 485 red flour beetle
3DU6_B 486 RTSFLVNDFGFIWLVLSSTVRAYASRAFKKIVTYKGGKYRKVTFQCLKSIAWRAFLAVLKRRTEIYKGLIDRIKSREKLT 565 red flour beetle
3DU6_B 486 RTSFLVNDFGFIWLVLSSTVRAYASRAFKKIVTYKGGKYRKVTFQCLKSIAWRAFLAVLKRRTEIYKGLIDRIKSREKLT 565 red flour beetle
3DU6_B 566 MKFHDGEVDASYFCKLPEKFRFVKINRKASI 596 red flour beetle
3DU6_B 566 MKFHDGEVDASYFCKLPEKFRFVKINRKASI 596 red flour beetle
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap