
Conserved Protein Domain Family

pfam00001: 7tm_1 
7 transmembrane receptor (rhodopsin family)
This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.
PSSM-Id: 394960
Aligned: 64 rows
Threshold Bit Score: 104.305
Threshold Setting Gi: 1540347406
Created: 21-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
CAP30519 396 iaaqlsalhtnekvfedpekfeperflknenliqqvipfgigkrsclgealakaelylvryadmvrpfgkksfsvderks 475 Caenorhabditis brig...
CAP30519 476 ivrghelgahpkilatqfscsssqiyrilkknrddngvvhrqspgrprttsrnmdrnilracredprrtstdiqlsvtsp 555 Caenorhabditis brig...
6A94_B   168 --FVLIGSFVSFFIPLTIMVITYFLTIKSLQKEAAdlednwetlndnlkviekadnaaqvkdaltkmraaaldagsgsgd 245 human
P08908   195 --YTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIR--------------------------------------------- 227 human
6G79_S   175 -lYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL--------------------------------------------- 208 human
P30966   200 --YTVFSTVGAFYLPLCVVLFVYWKIYRAAKFRMG--------------------------------------------- 232 house mouse
P34969   239 --YTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAA--------------------------------------------- 271 human
P20905   322 --YQIYATLGSFYIPLSVMLFVYYQIFRAARRIVL--------------------------------------------- 354 fruit fly
P08588   224 --YAIASSVVSFYVPLCIMAFVYLRVFREAQKQVK--------------------------------------------- 256 human
P21556   184 vlIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPV--------------------------------------------- 218 domestic guinea pig
P34972   188 ndYLLSWLLFIAFL-FSGIIYTYGHVLWKAHQHVA--------------------------------------------- 221 human
CAP30519 556 nepvpsrrtirrrlqvaglhgrrpvkkplvslknrkarvewakqhlswgprewanhiwsdeskfnmfgtdgiqwirrpig 635 Caenorhabditis brig...
6A94_B   246 ILVGqidda------------------------lklanEGKVKEaqaaaeqlktti------------------------ 277 human
P08908   228 KTVKkvektgadtrhgas-------papqpkksvngesGSRNWRlgveskaggalcangavrqgddgaalevievhrvgn 300 human
6G79_S   209 KQTPnrtgkrltraqlitdspgstssvtsinsrvpdvpSESGSPvyvnqvkvrvsd------------------------ 264 human
P30966   233 SRKTns-----------------------------------vsPvpeavevknatqhpqmvft----------------- 260 house mouse
P34969   272 KHK-----------------------------------FPGFPRvepdsvialngivklqkeve---------------- 300 human
P20905   355 EEKRaqthlqq---------------------alngtgSPSAPQapplghtelassgngqrhssvgntsltystcggls- 412 fruit fly
P08588   257 KIDScerr---------------------------flgGP-ARPpspspspvpapapppgpprpaaa------------- 295 human
P21556   219 KQQRna-------------------------------------------------------------------------- 224 domestic guinea pig
P34972   222 SLSG----------------------------------HQDRQVpg---------------------------------- 233 human
CAP30519 636 sryapqyqcptvkhgggsvmvwgcfsdtsmgplkrivgtmdryvyedilentmrpwaranlgrswvfqqdndpkhtsghv 715 Caenorhabditis brig...
6A94_B   278 --------------------------nayiqkygqsisNeQKACK---VLGIVFFLFVVMWCPFFITNIMAVI------- 321 human
P08908   301 skehlplpseagptpcapasferknernaeakrkmalaReRKTVK---TLGIIMGTFILCWLPFFIVALVLPF------- 370 human
6G79_S   265 ---------------------------allekkklmaaReRKATK---TLGIILGAFIVCWLPFFIISLVMPI------- 307 human
P30966   261 --------------------vrhatvtfqtegdtwreqKeQRAAL---MVGILIGVFVLCWFPFFVTELISPL------- 310 house mouse
P34969   301 ------------------ecanlsrllkherknisifkReQKAAT---TLGIIVGAFTVCWLPFFLLSTARPFi-----c 354 human
P20905   413 ---sgggalaghgsgggvsgstgllgsphhkklrfqlaKeKKAST---TLGIIMSAFTVCWLPFFILALIRPF------- 479 fruit fly
P08588   296 ----------------aataplangragkrrpsrlvalReQKALK---TLGIIMGVFTLCWLPFFLANVVKAF------- 349 human
P21556   225 ------------------------------------evR-RRALW---MVCTVLAVFVICFVPHHMVQLPWTLaelgmwp 264 domestic guinea pig
P34972   234 ------------------------------------maRmRLDVRlakTLGLVLAVLLICWFPVLALMAHSLA------- 270 human
CAP30519 716 anwfrrhrvnllewpsqspdlnpiehmweelerrlkgvRasnanqkfaqleaawksipmtvvqtllesmprrckavinak 795 Caenorhabditis brig...
6A94_B   322 CKESCNEDviGALlnvfvWIGYLSSAVNPLVY 353 human
P08908   371 CESSCHMP--TLLgaiinWLGYSNSLLNPVIY 400 human
6G79_S   308 CKDACWFH--LAIfdfftWLGYLNSLINPIIY 337 human
P30966   311 --CSWDVP--AIWksiflWLGYSNSFFNPLIY 338 house mouse
P34969   355 GTSCSCIP--LWVertflWLGYANSLINPFIY 384 human
P20905   480 --ETMHVP--ASLsslflWLGYANSLLNPIIY 507 fruit fly
P08588   350 --HRELVP--DRLfvffnWLGYANSAFNPIIY 377 human
P21556   265 SSNHQAIN--DAHqv-tlCLLSTNCVLDPVIY 293 domestic guinea pig
P34972   271 TTLSDQVK--KAFaf-csMLCLINSMVNPVIY 299 human
CAP30519 796 gyptky-------------------------- 801 Caenorhabditis briggsae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap