1HFX,1O23,6IP9,1A4V


Conserved Protein Domain Family
Lys

?
pfam00062: Lys 
Click on image for an interactive view with Cn3D
C-type lysozyme/alpha-lactalbumin family
Alpha-lactalbumin is the regulatory subunit of lactose synthase, changing the substrate specificity of galactosyltransferase from N-acetylglucosamine to glucose. C-type lysozymes are secreted bacteriolytic enzymes that cleave the peptidoglycan of bacterial cell walls. Structure is a multi-domain, mixed alpha and beta fold, containing four conserved disulfide bonds.
Statistics
?
PSSM-Id: 395016
View PSSM: pfam00062
Aligned: 12 rows
Threshold Bit Score: 171.45
Threshold Setting Gi: 157831331
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1HFX_A         1 KQLTKCALSHELN--DLAGYRDITLPEWLCIIFHISGYDTQAIVKN--SDHKEYGLFQINDKDFCESSTTVQSRNICDIS 76  domestic guinea...
P00697        19 KIYERCQFARTLKrnGMSGYYGVSLADWVCLAQHESNYNTQARNYNpgDQSTDYGIFQINSRYWCNDGKTPRAKNACGIP 98  Norway rat
1O23_C         1 TELTKCKVSHAIK--DIDGYQGISLLEWACVLFHTSGYDTQAVVND--NGSTEYGLFQISDRFWCKSSEFPESENICGIS 76  house mouse
P00716        20 TQLTRCELTEKLK--ELDGYRDISMSEWICTLFHTSGLDTKITVNN--NGSTEYGIFQISDKLWCVSKQNPQSKNICDTP 95  rabbit
P08334         1 KQFTKCELSQVLK--SMDGYKGVTLPEWICTIFHSSGYDTQTIVKN--NGKTEYGLFQINNKMWCRDNQILPSRNICGIS 76  horse
6IP9_A         1 EQLTKCEVFRELK--DLKGYGGVSLPEWVCTTFHTSGYDTQAIVQN--NDSTEYGLFQINNKIWCKDDQNPHSSNICNIS 76  cattle
XP_001491556  20 KVFSKCELAHKLKaqEMDGFGGYSLANWVCMAEYESNFNTRAFNGKnaNGSSDYGLFQLNNKWWCKDNK-RSSSNACNIM 98  horse
P83972        19 RTMDRCSLAREMSnlGVP---RDQLARWACIAEHESSYRTGVVGPEnyNGSNDYGIFQINDYYWCAPPSGRFSYNECGLS 95  fruit fly
P12067         1 KVYDRCEFARILKksGMDGYRGVSLANWVCLAKWESDFNTKAINRN--VGSTDYGIFQINSRYWCNDGKTPKAVNACHIS 78  pig
P80189        19 KVFERCELARSLKrfGMDNFRGISLANWMCLARWESNYNTQATNYNagDQSTDYGIFQINSHWWCNDGKTPGAVNACHLP 98  cattle
NP_001267639  19 KVFERCELARTLKklGLDDYKGVSLANWLCLTKWESGYNTKATNYNpgSESTDYGIFQINSKWWCNDGKTPNAVDGCHVS 98  sheep
1A4V_A         1 KQFTKCELSQLLK--DIDGYGGIALPELICTMFHTSGYDTQAIVEN--NESTEYGLFQISNKLWCKSSQVPQSRNICDIS 76  human
1HFX_A        77 CDKLLDDDLTDDIMCVKKIL-DIKGIDYWLAHKPLCS-DKLEQW--YC 120 domestic guinea pig
P00697        99 CSALLQDDITQAIQCAKRVVrDPQGIRAWVAWQRHCKnRDLSGYirNC 146 Norway rat
1O23_C        77 CDKLLDDELDDDIACAKKIL-AIKGIDYWKAYKPMCS-EKLEQW--RC 120 house mouse
P00716        96 CENFLDDNLTDDVKCAMKIL-DKEGIDHWLAHKPLCS-ENLEQW--VC 139 rabbit
P08334        77 CDKFLDDDLTDDVMCAKKIL-DSEGIDYWLAHKPLCS-EKLEQW--LC 120 horse
6IP9_A        77 CDKFLDDDLTDDIMCVKKIL-DKVGINYWLAHKALCS-EKLDQW--LC 120 cattle
XP_001491556  99 CSKLLDENIDDDISCAKRVVrDPKGMSAWKAWVKHCKdKDLSEYlaSC 146 horse
P83972        96 CNALLTDDITHSVRCAQKVL-SQQGWSAWSTW-HYCS-GWLPSId-DC 139 fruit fly
P12067        79 CKVLLDDDLSQDIECAKRVVrDPQGIKAWVAWRTHCQnKDVSQYirGC 126 pig
P80189        99 CGALLQDDITQAVACAKRVVsDPQGIRAWVAWRSHCQnQDLTSYiqGC 146 cattle
NP_001267639  99 CSALMENDIEKAVACAKHIV-SEQGITAWVAWKSHCRdHDVSSYveGC 145 sheep
1A4V_A        77 CDKFLDDDITDDIMCAKKIL-DIKGIDYWLAHKALCT-EKLEQW--LC 120 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap