3NTJ,1SF2


Conserved Protein Domain Family
Aminotran_3

?
pfam00202: Aminotran_3 
Click on image for an interactive view with Cn3D
Aminotransferase class-III
Statistics
?
PSSM-Id: 395148
Aligned: 13 rows
Threshold Bit Score: 364.341
Threshold Setting Gi: 1170030
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3NTJ_C  20 YGAHNYDPIP-VVLKRGKGVFVY-DIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKKLTICS-RAFFSDSLGVCERY 96  Plasmodium falciparum...
P38021  17 YGANNYHPLP-IVISEALGAWVK-DPEGNEYMDMLSAYSAVNQGHRHPKIIQALKDQADKITLTS-RAFHNDQLGPFYEK 93  Bacillus subtilis sub...
P80404  65 IQNAEAVHFF-CNYEESRGNYLV-DVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQNASMFVNrPALGILPPENFVEK 142 human
P46716  40 FSAVGGTP---LFITEARGCWLT-DADGRRYVDLVCSWGPMILGHAHPAVVDAVATVAASG--LSfGAPTPAETQLAAEI 113 Mycobacterium leprae TN
P46395  18 YAAPGVRN---RLVTKTDGVFLT-LEDGSTVIDAMSSWWSAIHGHGHPRLKAAAQKQIDTMSHVMfGGLTHEPAIKLTHK 93  Corynebacterium gluta...
P44426  19 YSSVSSDMPL-YAVERADGVMIT-LKDGRRLIDGMSSWWAALHGYNHPRLNAAAQNQLAKMSHIMfGGFTHDPAVELAQL 96  Haemophilus influenza...
P30268  19 SMAKDHPN---LPVVKEEGCYYY-GVDGVKYLDFTSGIAVTNVGHRHPKIVQAIKEAADHLTHGPiGVIQYESILKLADE 94  Bacillus pseudofirmus...
P40829  29 AVPRGVGVTLpVFVTRAAGGVIE-DVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCfIITPYEEYVAVTEQ 107 Mycobacterium leprae TN
1SF2_A  14 AIPRGVGQIHpIFADRAENCRVW-DVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCfQVLAYEPYLELCEI 92  Escherichia coli
P36839   7 TYGRWD-----IDIKKAKGTYVE-DQNGKTYLDFIQGIAVSNLGHCHEAVTEAVKKQLDSVWHVS-NLFQNSLQEQAAQK 79  Bacillus subtilis sub...
P18544  27 TYSRPED----LCITRGKNAKLYdDVNGKEYIDFTAGIAVTALGHANPKVAEILHHQANKLVHSS-NLYFTKECLDLSEK 101 Saccharomyces cerevis...
P18335  20 IYAPAE-----FIPVKGQGSRIW-DQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGETLWHIS-NVFTNEPALRLGRK 92  Escherichia coli K-12
P14010  65 VFDVRSLNML-ADYTKSVGNYIA-DLDGNMLLDVYAQIASIPVGYNNPHLLKVAASPEMATSLINrPALGNFPSADWAHI 142 Aspergillus nidulans ...
3NTJ_C  97 L----TNLFGY--D---KVLMMNTGAEASETAYKLCRKWGYEVKkiPENSA--------------------KIIVCNNNF 147 Plasmodium falciparum...
P38021  94 T----AKLTGK--E---MILPMNTGAEAVESAVKAARRWAYEVKgvADNQA--------------------EIIACVGNF 144 Bacillus subtilis sub...
P80404 143 LrqslLSVAPKgmS---QLITMACGSCSNENALKTIFMWYRSKE--RGQRGfsqeeletcminqapgcpdySILSFMGAF 217 human
P46716 114 I----GRMAPV--E---RIRLVNSGTEATMSAVRLARG--------FTGRT--------------------KIIKFSGCY 156 Mycobacterium leprae TN
P46395  94 L----LNLTGNsfD---HVFYSDSGSVSVEVAIKMALQASKGQG--HPERT--------------------KLLTWRSGY 144 Corynebacterium gluta...
P44426  97 L----VQILPNglD---KIFFADSGSVAVEVAMKMAIQYQHAKG--EVQRQ--------------------KFATIRSGY 147 Haemophilus influenza...
P30268  95 L----ADILPGdlD---CFFFANSGTEAIEGALKLAKF--------VTKRP--------------------YVVSFTGCF 139 Bacillus pseudofirmus...
P40829 108 L----NRITPG--SgekRSVLFNSGAEAVENSIKVARS--------YTRKP--------------------AVVAFDHAY 153 Mycobacterium leprae TN
1SF2_A  93 M----NQKVPG--DfakKTLLVTTGSEAVENAVKIARA--------ATKRS--------------------GTIAFSGAY 138 Escherichia coli
P36839  80 L----AAHSAG--D---LVFFCNSGAEANEGAIKLARK--------ATGKT--------------------KIITFLQSF 122 Bacillus subtilis sub...
P18544 102 Ive-kTKQFGGqhDa-sRVFLCNSGTEANEAALKFAKKHGIMK---NPSKQ--------------------GIVAFENSF 156 Saccharomyces cerevis...
P18335  93 L----IEATFA--E---RVVFMNSGTEANETAFKLARHYACVRH--SPFKT--------------------KIIAFHNAF 141 Escherichia coli K-12
P14010 143 LktgiLKVAPKglD---QVFTAMAGSDANETAYKAAFMYYRQQQrgGPEKEfteeeiqssmlnqtpgspqlSIMSFKAGF 219 Aspergillus nidulans ...
3NTJ_C 148 SGRTLGCVSASTD-KKCKNNFGPF---VPNFLKVPYDD----------------------LEALEk--ELQDPNVCAFIV 199 Plasmodium falciparum...
P38021 145 HGRTMLAVSLSSE-EEYKRGFGPM---LPGIKLIPYGD----------------------VEALR---QAITPNTAAFLF 195 Bacillus subtilis sub...
P80404 218 HGRTMGCLATTHSkAIHKIDIPSFdwpIAPFPRLKYPLeefvkenqq-----eearcleeVEDLIvkyRKKKKTVAGIIV 292 human
P46716 157 HGHVDALLADAGS--GVATLSLPS---SPGVTGAAAADtivl--------------pyndIEAVRqtfARLGDQIAAVIT 217 Mycobacterium leprae TN
P46395 145 HGDTFTAMSVCDPeNGMHSLWKGT---LPEQIFAPAPpvrgssp----------qaiseyLRSME---LLIDETVSAIII 208 Corynebacterium gluta...
P44426 148 HGDTWNAMSVCDPtTGMHHLFHHS---LPVQYFLPQPnipfnesw--------ndcaiepLADLL---KKKGNEIAALIL 213 Haemophilus influenza...
P30268 140 HGRTQGSLGVSTSkSKYRKFLQPNg-lTYQVPYFKPSDprildeegevveslacelleeeFTNLFk-yHVSSEEVAAVIL 217 Bacillus pseudofirmus...
P40829 154 HGRTNLTMALTAKsMPYKSGFGPF---APEIYRAPLSYpyrdgllnkdlatdgklagaraINVIEk--QVGADDLAAVII 228 Mycobacterium leprae TN
1SF2_A 139 HGRTHYTLALTGKvNPYSAGMGLM---PGHVYRALYPCplhgisedd-----aiasihriFKN-----DAAPEDIAAIVI 205 Escherichia coli
P36839 123 HGRTYAGMAATGQ-DKIKTGFGPM---LGGFHYLPYNDps-------------------aFKALG-----EEGDIAAVML 174 Bacillus subtilis sub...
P18544 157 HGRTMGALSVTWN-SKYRTPFGDL---VPHVSFLNLNDem------------------tkLQSYI---ETKKDEIAGLIV 211 Saccharomyces cerevis...
P18335 142 HGRSLFTVSVGGQ-PKYSDGFGPK---PADIIHVPFND----------------------LHAVK---AVMDDHTCAVVV 192 Escherichia coli K-12
P14010 220 HGRLFGSLSTTRSkPIHKLDIPAFdwpQAPFPSLKYPLeehakenae-----eeqrclqeAERLI---KEWHNPVAAIIV 291 Aspergillus nidulans ...
3NTJ_C 200 EP-VQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGL--GRTGKLLCTHHY--GVKPDVILLG-KALSGGhYPISA 273 Plasmodium falciparum...
P38021 196 EP-IQGEAGIVIPPEGFLQEAAAICKEENVLFIADEIQTGL--GRTGKTFACDWD--GIVPDMYILG-KALGGGvFPISC 269 Bacillus subtilis sub...
P80404 293 EP-IQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGG--GCTGKFWAHEHWglDDPADVMTFSkKMMTGG-FFHKE 368 human
P46716 218 EA-SPGNMGVVPPAPGYNAALRAITAEHGALLIIDEVMTGFrvSRSG-WYGLD----PVAADLFIFG-KVMSGG-MPAAA 289 Mycobacterium leprae TN
P46395 209 EPiVQGAGGMRFHDVALIEGVATLCKKHDRFLIVDEIATGF--GRTGELFATLSN--GLQPDIMCVG-KALTGGfMSFAA 283 Corynebacterium gluta...
P44426 214 EPvVQGAGGMYFYSPTYLVKAQALCKQYGILLIFDEIATGF--GRTGKLFAAEHA--GISPDIMCIG-KALTGGyLTLSA 288 Haemophilus influenza...
P30268 218 EP-VLGEGGYIIPPASWLAKVREICNRHDILLIFDEVQTGF--GRTGEWFAAQTF--GVTPDIMAIA-KGIASG-LPLSA 290 Bacillus pseudofirmus...
P40829 229 EP-IQGEGGFIVPAEGFLATLLDWCRKNNVMFIADEVQTGF--ARTGAMFACEHD--GIVPDLICTA-KGIADG-LPLAA 301 Mycobacterium leprae TN
1SF2_A 206 EP-VQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGA--GRTGTLFAMEQM--GVAPDLTTFA-KSIAGG-FPLAG 278 Escherichia coli
P36839 175 ET-VQGEGGVNPASAEFLSAVQSFCKEKQALLIIDEIQTGI--GRTGKGFAYEHF--GLSPDIITVA-KGLGNG-FPVGA 247 Bacillus subtilis sub...
P18544 212 EP-IQGEGGVFPVEVEKLTGLKKICQDNDVIVIHDEIQCGL--GRSGKLWAHAYLpsEAHPDIFTSA-KALGNG-FPIAA 286 Saccharomyces cerevis...
P18335 193 EP-IQGEGGVTAATPEFLQGLRELCDQHQALLVFDEVQCGM--GRTGDLFAYMHY--GVTPDILTSA-KALGGG-FPISA 265 Escherichia coli K-12
P14010 292 EP-IQSEGGDNHASPAFFRGLREITKRNNVLFIVDEVQTGV--GATGKFWAHDHWnlETPPDMVTFSkKAQTAGyYFGNP 368 Aspergillus nidulans ...
3NTJ_C 274 ILANDDVMLVLkpg------ehgSTYGGNPLAAAICVEALKVLIN---EKLCENADKLGAPFLQNLKEQLKDs-kVVREV 343 Plasmodium falciparum...
P38021 270 IAADREILGVFnpg------shgSTFGGNPLACAVSIASLEVLED---EKLADRSLELGEYFKSELESIDSP---VIKEV 337 Bacillus subtilis sub...
P80404 369 EFRPNAPYRIF------------NTWLGDPSKNLLLAEVINIIKR---EDLLNNAAHAGKALLTGLLDLQARypqFISRV 433 human
P46716 290 FGGRAEVMERLaplgp---vyqaGTLSGNPVAMAAGLATLRAAADavyATLDRNADRLVAMLSEALTDAG-----VPHQI 361 Mycobacterium leprae TN
P46395 284 TLCTDKVAQLIstpngggalmhgPTFMANPLACAVSHASLEIIET---GMWQKQVKRIEAELIAGLSPLQHLp--GVADV 358 Corynebacterium gluta...
P44426 289 SITTTEIAQTIcsgeak-cfmhgPTFMANPLACAIAAESIRLLLE---SPWQQNIQRIESSLKQQLSPLSEKd--YVKEV 362 Haemophilus influenza...
P30268 291 TVANHKLMQQWplg------shgTTFGGNPIACSAALATLDVLKE---ENLLDNAREVGAYARERLNLLKEKy-eMIGSI 360 Bacillus pseudofirmus...
P40829 302 VTGRAEIMNAPhvs------glgGTFGGNPVACAAALATITTIEN---DGLIQRAQQIERLITDRLLRLQDAd-dRIGDV 371 Mycobacterium leprae TN
1SF2_A 279 VTGRAEVMDAVapg------glgGTYAGNPIACVAALEVLKVFEQ---ENLLQKANDLGQKLKDGLLAIAEKh-pEIGDV 348 Escherichia coli
P36839 248 VIGKKQLGEAFtpg------shgTTFGGNMLAMAAVNATLQIVFQ---PDFLQEAADKGAFLKEQLEAELKSp--FVKQI 316 Bacillus subtilis sub...
P18544 287 TIVNEKVNNALrvg------dhgTTYGGNPLACSVSNYVLDTIAD---EAFLKQVSKKSDILQKRLREIQAKypnQIKTI 357 Saccharomyces cerevis...
P18335 266 MLTTAEIASAFhpg------shgSTYGGNPLACAVAGAAFDIINT---PEVLEGIQAKRQRFVDHLQKIDQQy-dVFSDI 335 Escherichia coli K-12
P14010 369 ALRPNKPYRQF------------NTWMGDPSRALIFRGIIEEIER---LFLVENTAATGDYLYSGLERLAKQypeHLQNL 433 Aspergillus nidulans ...
3NTJ_C 344 RGK--GLLCAIEFKNDLVnv-------------wdICLKFKENGLITRSVHD--KTVRLTPPLCITKEQLDECTEIIVKT 406 Plasmodium falciparum...
P38021 338 RGR--GLFIGVELTEAARp----------------YCERLKEEGLLCKETHD--TVIRFAPPLIISKEDLDWAIEKIKHV 397 Bacillus subtilis sub...
P80404 434 RGR--GTFCSFDTPDDSIrn--------------kLILIARNKGVVLGGCGD--KSIRFRPTLVFRDHHAHLFLNIFSDI 495 human
P46716 362 PRA--GNMFSV-FFSEAPvtdfasacnsqvwrypaFFHALLDAGVY--------PPCSTFEAWFVSAALDDAAFGRIVDA 430 Mycobacterium leprae TN
P46395 359 RVL--GAIGVIEMEQNVNve--------------eATQAALDHGVWIRPFG---RLLYVMPPYITTSEQCAQICTALHAA 419 Corynebacterium gluta...
P44426 363 RAL--GAIGVVEMKSAVNmk--------------tLVPRFVEQGVWIRPFG---KLVYVMPPFVIKDDELQKLTEGMILA 423 Haemophilus influenza...
P30268 361 RSV--GLMIGIEIIDPQTkkpdg-------aavlrILDLALQEGVLFYLCGNegEVIRMIPPLSVTKEQIDDGLDMLQRA 431 Bacillus pseudofirmus...
P40829 372 RGR--GAMIAVELVKSGTaepdp-------eltekVATAAHATGVIILTCGMfgNIIRLLPPLTISDELLAEGLDILSRI 442 Mycobacterium leprae TN
1SF2_A 349 RGL--GAMIAIELFEDGDhnkpda------kltaeIVARARDKGLILLSCGPyyNVLRILVPLTIEDAQIRQGLEIISQC 420 Escherichia coli
P36839 317 RGK--GLMLGIECDGPVAd----------------IIAELQTLGLLVLPAGP--NVIRLLPPLTVTKDEIAEAVSKLKQA 376 Bacillus subtilis sub...
P18544 358 RGK--GLMLGAEFVEPPTe----------------VIKKARELGLLIITAGK--STVRFVPALTIEDELIEEGMDAFEKA 417 Saccharomyces cerevis...
P18335 336 RGM--GLLIGAELKPQYKgra------------rdFLYAGAEAGVMVLNAGP--DVMRFAPSLVVEDADIDEGMQRFAHA 399 Escherichia coli K-12
P14010 434 RGKgqGTFIAWDTPKRDE-----------------FLVKGKGVGINIGGSGQ--NAVRLRPMLIFQKHHADILLESIEKI 494 Aspergillus nidulans ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap