5FT8,6O11,5ZSK,1BJO


Conserved Protein Domain Family
Aminotran_5

?
pfam00266: Aminotran_5 
Click on image for an interactive view with Cn3D
Aminotransferase class-V
This domain is found in amino transferases, and other enzymes including cysteine desulphurase EC:4.4.1.-.
Statistics
?
PSSM-Id: 395204
Aligned: 35 rows
Threshold Bit Score: 268.346
Threshold Setting Gi: 505028498
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5FT8_G               23 VYLDSAATALKPEAVVEATQQFYSLSAGNVHR--SQFAEAQRLTARYEAAREKVAQLLNAPDDKTIVWTRGTTE-SINMV 99  Escheric...
P25374              100 IYLDMQATTPTDPRVLDTMLKFYTGLYGNPHS--NTHSYGWETNTAVENARAHVAKMINAD-PKEIIFTSGATE-SNNMV 175 Saccharo...
P38033                2 IYLDYAATTPICEEALTVYQKLSMDMYGNA-S--SLHDAGGKAKHILEYCREKIANIIGGE-ASGIYFTSGGTE-SNFLA 76  Bacillus...
P12623                4 IYLDNNATTKVDPDVVEAIMPYLTDYYGNP-S--SMHTFGGQLGKAVRTAREQVAALLGAD-ESEIVFTSCGTE-GDNAA 78  Nostoc s...
rhodo:RCAP_rcc03270   6 IYLDNNATTRVFPEVVAAMLPYFTEHFGNA-S--SGHGFGAQAGLGLRKARLAVAALIGAASEQEILFTSGGTE-ANTTA 81  Rhodobac...
P10658                7 IVNFGPGPAKLPHSVLLEIQKELLDYKGLGISvlEMSHRSSDFAKIVNNTENLVRELLAVPDNYKVIFLQGGGCgQFSAV 86  rabbit
1BJO_B                2 IFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSvmEVSHRGKEFIQVAEEAEKDFRDLLNVPSNYKVLFCHGGGRgQFAAV 81  Escheric...
P44336                4 VFNFSAGPAMIFPEVLQKAQNELINWLNQGVSvmEVSHRGKYFMELVTQAEKDLREVYNIPDNYRTLFLQGGARgQFATI 83  Haemophi...
P31029               45 RLLLGPGPSNLPPRTMAAGGLQ------------MLGHMHKETYQIMDEIKEGIQYVFQTRN-PLTLVISGSGHcALEAA 111 white-tu...
Q9PQ36               18 IYLDSSATSLKPQVVIDAIVDYYTKYSTNPHN--TDSNFTFHTHEIMNETRANVAKFINANF-DEIIFTSGATE-SLNLI 93  Ureaplas...
5FT8_G              100 AQCYARPrLQPGDEIIVSVAEHHANLVPWLMVAQQTGAKVVKLPLNAQRLPD--VDLL-PELIT-PRSRILALGQMSNVT 175 Escheric...
P25374              176 LKGVPRFyKKTKKHIITTRTEHKCVLEAARAMM-KEGFEVTFLNVDDQGLID--LKEL-EDAIR-PDTCLVSVMAVNNEI 250 Saccharo...
P38033               77 IQSLLNGlPKTKRHFITTAMEHQSIHNCAAFLE-QQGYDVTVIEPNEYGLIT--EEIL-LTHIR-PETGLVSIQHANSET 151 Bacillus...
P12623               79 IRAALLA-QPEKRHIITTQVEHPAVLNVCKQLE-TQGYTVTYLSVNSHGQLD--LDEL-EASLT-GNTALVTIMYANNET 152 Nostoc s...
rhodo:RCAP_rcc03270  82 IRSALAV-QDGRREIIISAVEHPAILMLAADLEKTEGVRVHRIPVDHLGRLD--LAAY-RAALS-DRVAVASIMWANNET 156 Rhodobac...
P10658               87 PLNLIG--LKPGRCADYVVTGAWSAK-AAEEAKKFGTVNIVHPKL---GSYTkiPDPS-TWNLN-PDASYVYYCANETVH 158 rabbit
1BJO_B               82 PLNI----LGDKTTADYVDAGYWAAS-AIKEAKKYCTPNVFDAKVTVDGLRA--VKPMrEWQLS-DNAAYMHYCPNETID 153 Escheric...
P44336               84 PMNL----IGKKGKALYLNSGHWSAT-AAKEARNF--AEIDEITIVENGEQTriTDLD-FSHIA-DQYDYVHYCPNETIS 154 Haemophi...
P31029              112 LINV----LEPGDSFLVGVNGIWGQR--AADIGERLGARVHPMTKDPGGHYT--LQEV-EEGLAqHKPVLLFLTHGESSS 182 white-tu...
Q9PQ36               94 ANGLRPH-LKKGDEIILTYIEHASNLLPWYKLRDDLGVKI-IFANQKNQFPQ--LSDF-LKVIS-PKTKVVSFASGGNLI 167 Ureaplas...
5FT8_G              176 GG-CPDLARAITFAHS-Ag-MVVMVDGAQGAVHFPADVQQLDIDFYAFSGHK-LYGPTGIGVLYGKSELLEAM--SPWLG 249 Escheric...
P25374              251 GV-IQPIKEIGAICRK-Nk-IYFHTDAAQAYGKIHIDVNEMNIDLLSISSHK-IYGPKGIGAIYVRRRPRVRL--EPLLS 324 Saccharo...
P38033              152 GI-IQPIQHLSSYLHN-Kg-ILLHCDAVQTFGKIPINTKNLGVDALSMSSHK-IHGPKGVGAVYIRP--DVPW--KPVYP 223 Bacillus...
P12623              153 GT-VFPIEEIGKRVKE-Rg-AIFHVDAVQAVGKIPLNMKTSTIDMLTISGHK-IHAPKGIGALYVRR--GVRF--RPLLI 224 Nostoc s...
rhodo:RCAP_rcc03270 157 GT-IFPVPQLAAEAHA-Ag-ALFHTDAVQAVGKLPMSLADTEIDMLSLSGHK-FHGPKGVGALYLRK--GVAF--RPLLR 228 Rhodobac...
P10658              159 GVeFDFVPDVKg--------AILVCDMSSNFLSRPVDVSKFGV--IFAGAQK-NVGAAGVTVVIVRDDLLGFA------- 220 rabbit
1BJO_B              154 GIaIDETPDFG------Ad-VVVAADFSSTILSRPIDVSRYGV--IYAGAQX-NIGPAGLTIVIVREDLLGKA------- 216 Escheric...
P44336              155 GVeIFDVPNVGn--------AVLVADMSSNILSRQIDISKFGV--IYAGAQK-NLGPAGITLVIIRDDLIGNA------- 216 Haemophi...
P31029              183 GV-LQPLDGFGELCHR-Yk-CLLLVDSVASLGGAPLYMDQQGIDILYSGSQKvLNAPPGTSLLSFSDTAKNKIysRKTKP 259 white-tu...
Q9PQ36              168 GN-VLDENLIIKNIKKiKpdVLVCVDATQSIQHRMFDVKKCKSDFMVFSAHK-LLGPTGIGVAYIKNDLIKKM--QPLKY 243 Ureaplas...
5FT8_G              250 GGKMVHEVSF-DGFTTQSAPWKLEAGTPNVAGVIGLSAALEWL-ADYDINQAESWSRSLATLAEDALAK-RPGFRSFR-- 324 Escheric...
P25374              325 GGG--------QERG-------LRSGTLAPPLVAGFGEAARLM--KKEFDNDQAHIKRLSDKLVKGLLS-AEHTTLNGsp 386 Saccharo...
P38033              224 LTT--------HEYG-------FRAGTVNVPGIGAFTAAAELIvSEMEKQISRNEALRTYFLDQIRIRS-LPVTLAADts 287 Bacillus...
P12623              225 GGH--------QERG-------RRAGTENVPGIVGLGKAAELE--LIHIETAIKKETRLRDRLEQTLLAkIPDCEVNGdi 287 Nostoc s...
rhodo:RCAP_rcc03270 229 GGK--------QERG-------RRAGTENVPALVGMGLAAEIV--AARMAADLSRIATLRDWLESGILA-LGGCQRLGdp 290 Rhodobac...
P10658              221 ---LRECPSVlEYKVQATSSSLYN--TPPCFSIYVMGLVLEWIkNNGGAAAMKKLSTIKSQMIYEIIDN-SQGFYVcp-- 292 rabbit
1BJO_B              217 ---NIACPSIlDYSILNDNGSMFN--TPPTFAWYLSGLVFKWLkANGGVAEMDKINQQKAELLYGVIDN-SDFYRNdv-- 288 Escheric...
P44336              217 ---RKETPSIwNYATQRDADSMIN--TPPTFAWYLCSLVFKHLkEIGGLEIIEKRNALKAQTLYDYIDS-SKLYRNvv-- 288 Haemophi...
P31029              260 SSFYLDVKYLaNLWGCDGQPRMYHh-TTPVVSLYSLREGLALL-SEQGLENSWRKHREAAAYLHGRLQA-LGLRLFvkd- 335 white-tu...
Q9PQ36              244 GGGMNFSIDL-NSYQLYDNYMKFEGGTPHVAGFYGFNAALKFL-MDIGYNKIHEHELKITKYARDQLAL-IPEIKTyv-- 318 Ureaplas...
5FT8_G              325 --CQDSSLLAFDF-AGVHH----SDMVTLLAEY-GIALRA--GQHCA----QPLLAELGVT-------GTLRAS-FAPYN 382 Escheric...
P25374              387 -dHRYPGCVNVSF-AYVEG----ESLLMALRD---IALSS--GSACTsaslEPSYVLHALGkddalahSSIRFG-IGRFS 454 Saccharo...
P38033              288 kaECLPHIIGCFF-HSFEG----QYVMLECNRS-NICIST--GSACSagyhGPSETMKALRkteqealQFIRIS-FGRHT 358 Bacillus...
P12623              288 -tQRLPNTTNIGF-KYIEG----EAILLSLNKY-GICASS--GSACTsgslEPSHVLRAMGlpyttlhGSIRFS-LCRYT 357 Nostoc s...
rhodo:RCAP_rcc03270 291 -aNRLANTCTLAF-DRIDS----EAVLTKLARA-GIAIST--GSACAsgamEPSHVTRAMAvpftaahGVVRFS-LSADT 360 Rhodobac...
P10658              293 vePRNRSMMNIPF-RIGNAkgdeALEKRFLDKAlELHMISlkGHRSV---------------------GGVRVS-LYNAV 349 rabbit
1BJO_B              289 -aKRNRSRMNVPF-QLADS----ALDKLFLEESfAAGLHAlkGHRVV---------------------GGMRAS-IYNAM 340 Escheric...
P44336              289 -aKENRSTMNVTF-ITGNP----ELDAKFVAEStAAGLQAlkGHKVL---------------------GGMRAS-IYNAM 340 Haemophi...
P31029              336 paLRLPTVTTVAVpTGYDW----RDIVSYLIERfGIEITGglGPSTG---------------------KVLRIGlMGCNA 390 white-tu...
Q9PQ36              319 -qDATSSTITFSY-NGVFC----QDFANYLGSK-NIIVRS--GLSCA----KIINNVIQTE-------CAIRAS-FYIYN 377 Ureaplas...
5FT8_G              383 TKSDVDAL 390 Escherichia coli K-12
P25374              455 TEEEVDYV 462 Saccharomyces cerevisiae S288C
P38033              359 TAEQLEQL 366 Bacillus subtilis subsp. subtilis str. 168
P12623              358 TEAQIDRV 365 Nostoc sp. PCC 7120 = FACHB-418
rhodo:RCAP_rcc03270 361 TAAELSRV 368 Rhodobacter capsulatus SB 1003
P10658              350 TIEDVQKL 357 rabbit
1BJO_B              341 PLEGVKAL 348 Escherichia coli
P44336              341 SQNGVEAL 348 Haemophilus influenzae Rd KW20
P31029              391 TRENVDLV 398 white-tufted-ear marmoset
Q9PQ36              378 DFNDVDRL 385 Ureaplasma parvum serovar 3 str. ATCC 700970
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap