4E1O,3K40,1XEY


Conserved Protein Domain Family
Pyridoxal_deC

?
pfam00282: Pyridoxal_deC 
Click on image for an interactive view with Cn3D
Pyridoxal-dependent decarboxylase conserved domain
Statistics
?
PSSM-Id: 395219
Aligned: 9 rows
Threshold Bit Score: 412.582
Threshold Setting Gi: 55670836
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4E1O_E        40 PGYLRA---QLPESAPEDPDSWDSIFGDIERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPAC 116 human
P34751       377 PGYLKA---LLPPKAPQKAEDIDDILEDYHKLIVPGLSHSSHPNFHSFYPAGNSFHCLLADLLGGHIGDAGFYWTSNPAL 453 Caenorhabditis ...
P27718        35 PGYLRP---LIPTTAPQEPETFEAIIEDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPAC 111 cattle
Q05733        35 PGYMRQ---LLPESAPIEGEPWPKIFSDVERIVMPGITHWQSPHMHAYFPALNSMPSLLGDMLADAINCLGFTWASSPAC 111 fruit fly
3K40_B        35 PGYLKP---LIPDAAPEKPEKWQDVMQDIERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPAC 111 fruit fly
1XEY_A        33 PLHEMR----DDVAFQIIND-ELYLDGNARQNLATFCQTWDDENVHKLMD--------------LSINKNWIDKEEYPQS 93  Escherichia coli
NP_001233822  33 PENSIP----KEAAYQIIND-ELMLDGNPRLNLASFVTTWMEPECDKLMM--------------DSINKNYVDMDEYPVT 93  tomato
P14748       144 PHQLLEgmeGFNLELSDHPESLEQILVDCRDTLKYGVRTGH-PRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVF 222 domestic cat
P20228        64 PEDMKR---LLDLDVPDRALPLQQLIEDCATTLKYQVKTGH-PHFFNQLSNGLDLISMAGEWLTATANTNMFTYEIAPVF 139 fruit fly
4E1O_E       117 TELEMNVMDWLAKMLGLPEHFLHhhPssqGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESSLNARLVAYASDQ 196 human
P34751       454 TELEVLMMDWLGEMMALPKEFLLfpEasrGGGCMQRSDTESNFLVLVAARTDMIRRMKQRDKRLRSSDILARLVAYTSSD 533 Caenorhabditis ...
P27718       112 TELETVMMDWLGKMLQLPEAFLAg-EageGGGVIQGTASEATLVALLAARTKVTRHLQAASPELMQAAIMEKLVAYASDQ 190 cattle
Q05733       112 TELEIIVMNWLGKMIGLPDAFLHlsSqsqGGGVLQTTASEATLVCLLAGRTRAIQRFHERHPGYQDAEINARLVAYCSDQ 191 fruit fly
3K40_B       112 TELEVVMMDWLGKMLELPAEFLAcsGg-kGGGVIQGTASESTLVALLGAKAKKLKEVKELHPEWDEHTILGKLVGYCSDQ 190 fruit fly
1XEY_A        94 AAIDLRCVNMVADLWHAPAPKNGq-----AVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKP------TDKPNLVCGP- 161 Escherichia coli
NP_001233822  94 TELQNRCVNMIAHLFNAPLEDGEt-----AVGVGTVGSSEAIMLAGLAFKRKWQNKMKAQGKP------YDKPNIVTGAN 162 tomato
P14748       223 VLMEQITLKKMREIVGWS----Sk-D---GDGIFSPGGAISNMYSIMAARYKFFPEVKTKGMAAVP-----KLVLFTSEH 289 domestic cat
P20228       140 ILMENVVLTKMREIIGWS----G------GDSILAPGGSISNLYAFLAARHKMFPNYKEHG----SVGLPGTLVMFTSDQ 205 fruit fly
4E1O_E       197 AHSSV--EKAGLISLVK---MKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAFDXLSELGPICAR-- 269 human
P34751       534 ARRSIkmKMAAEVAMVK---MRVLPTDQNFILRGDTLHAAIMADIERGLIPFFVGANFGTSGPCSFDHLHELGPVCRE-- 608 Caenorhabditis ...
P27718       191 AHSSV--EKAGLIGGVR---LKAIPSDGKFAMRASALQEALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICHE-- 263 cattle
Q05733       192 AHSSV--EKAALIGLVR---MRYIEADDDLAMRGKLLREAIEDDIKQGLVPFWVCATLGTTGSCSFDNLEEIGIVCAE-- 264 fruit fly
3K40_B       191 AHSSV--ERAGLLGGVK---LRSVQSE-NHRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNK-- 262 fruit fly
1XEY_A       162 VQICW--HKFARYWDVE---LREIPMRP-G-QLFMDPKRMIEACDEN--TI-GVVPTFGVTYTGNYEFPQPLHDALDKfq 231 Escherichia coli
NP_001233822 163 VQVCW--EKFARYFEVE---LKEVKLTD-G-YYVMSPEKAVEMVDEN--TI-CVAAILGSTLNGEFEDVKKLNDLLIEkn 232 tomato
P14748       290 SHYSI--KKAGAALGFGtdnVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIADICEK-- 365 domestic cat
P20228       206 CHYSI--KSCAAVCGLGtdhCIVVPSDEHGKMITSELERLILERKAKGDIPFFVNATAGTTVLGAFDDINTIADICQK-- 281 fruit fly
4E1O_E       270 ----EGLWLHIDAAYAGTAFLCPEFRG---FLKGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFsvnpiyLRhA 342 human
P34751       609 ----HGTWLHVDAAYAGTALICPEIRG---LMRGIDWADSFCTTPSKLIIAVCDVCCLWVRDRHKLQHAS------LE-N 674 Caenorhabditis ...
P27718       264 ----EGLWLHVDAAYAGSAFICPEFRH---LLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFrldpvyLRhS 336 cattle
Q05733       265 ----HHLWLHVDAAYAGSAFICPEFRT---WLRGIERADSIAFNPSKWLMVHFDATALWVRDSTAVHRTFnveplyLQhE 337 fruit fly
3K40_B       263 ----HNLWIHVDAAYAGSAFICPEYRH---LMKGIESADSFNFNPHXWMLVNFDCSAMWLKDPSWVVNAFnvdplyLKhD 335 fruit fly
1XEY_A       232 adtgIDIDMHIDAASGG--FLAPFVAPdivWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELvfnvdyLG-- 307 Escherichia coli
NP_001233822 233 ketgWDTPIHVDAASGG--FIAPFIYPeleWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPDELifhinyLG-- 308 tomato
P14748       366 ----YNLWLHVDAAWGGGLLMSRKHRH---KLSGIERANSVTWNPHKMMGVLLQCSAILVKEKGILQGCNqmcagyLFqP 438 domestic cat
P20228       282 ----YNCWMHIDAAWGGGLLMSRKHRHp--RFTGVERADSVTWNPHKLMGALLQCSTIHFKEDGLLISCNqmsaeyLFmT 355 fruit fly
4E1O_E       343 Nsg--vaTDFMHWQIPLSR--RFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPS-FEIPA---KRHLGLVV 414 human
P34751       675 H------PDLPFKGLPTSQ--RVGALKIWFMIRSFGVENLQNQIREHIRLGQVMTKILQKDLR-FEVCN---KVVMGLIC 742 Caenorhabditis ...
P27718       337 HqdsgliTDYRHWQLPLGR--RFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHAFEALVRQDTR-FEICA---EVILGLVC 410 cattle
Q05733       338 Nsg--vaVDFMHWQIPLSR--RFRALKVWFVLRSYGIKGLQRHIREGVRLAQKFEALVLADHR-FELPA---KRHLGLVV 409 fruit fly
3K40_B       336 Mqg--saPDYRHWQIPLGR--RFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSR-FELAA---EINMGLVC 407 fruit fly
1XEY_A       308 -------GQIGTFAINFSRpaGQVIAQYYEFLR-LGREGYTKVQNASYQVAAYLADEIAKLGPyEFICTgrpDEGIPAVC 379 Escherichia coli
NP_001233822 309 -------ADQPTFTLNFSKgsSQVIAQYYQLIR-LGYEGYKNVMENCQENARVLREGLEKTGR-FEIVSk--EVGVPLVA 377 tomato
P14748       439 DkqydvsYDTGDKAIQCGR--HVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREE-FEMVFd-gEPEHTNVC 514 domestic cat
P20228       356 DkqydisYDTGDKVIQCGR--HNDIFKLWLQWRAKGTEGFEQQQDRLMELVQYQLKRIREQSDrFHLIL---EPECVNVS 430 fruit fly
4E1O_E       415 FRLK 418 human
P34751       743 FRAK 746 Caenorhabditis elegans
P27718       411 FRLK 414 cattle
Q05733       410 FRIR 413 fruit fly
3K40_B       408 FRLK 411 fruit fly
1XEY_A       380 FKLK 383 Escherichia coli
NP_001233822 378 FSLK 381 tomato
P14748       515 FWYI 518 domestic cat
P20228       431 FWYV 434 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap