2GQ1


Conserved Protein Domain Family
FBPase

?
pfam00316: FBPase 
Fructose-1-6-bisphosphatase, N-terminal domain
This family represents the N-terminus of this protein family.
Statistics
?
PSSM-Id: 395249
Aligned: 9 rows
Threshold Bit Score: 243.085
Threshold Setting Gi: 1173345
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2GQ1_A         2 KTLGEFIVEKQHEFS-HATGE-----LTALLSAIKLGAKIIHRDINKAGLVDILGASGAENVQGEVQQKLDLFANEKLKA 75 
Q05079        19 ITLSRFILDQQHLSAkNATGE-----FSMLLNSLQFAFKFISQTIRRAELVNLIGLAGASNSTGDQQKKLDVLGDEIFIN 93  Kluyveromyces l...
P09201        21 ITLPRFIIEHQKQFK-NATGD-----FTLVLNALQFAFKFVSHTIRRAELVNLVGLAGASNFTGDQQKKLDVLGDEIFIN 94  Saccharomyces c...
XP_002891265  13 MTITRFVLNEQSKYP-ESRGD-----FTILLSHIVLGCKFVCSAVNKAGLAKLIGLAGETNIQGEEQKKLDVLSNDVFVK 86  Arabidopsis lyr...
XP_002820025  12 nTLTRFVMEEGRKAR--GTGE-----LTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMN 84  Sumatran orangutan
Q328V4         2 kTLGEFIVEKQHEFS-HATGE-----LTALLSAIKLGAKIIHRDINKAGLVDILGASGAENVQGEVQQKLDLFANEKLKA 75  Shigella dysent...
P46283        69 STVTKCEIGQSLEEF--LAQAtpdkgLRTLLMCMGEALRTIAFKVRTAS----CGGTACVNSFGDEQLAVDMLADKLLFE 142 thale cress
Q3SP44         5 MTLQERMDGEGGSDP--LRQA-----VKGAVAALAQAAIDISDLTCRGALAGITGQAQGRNTDGDVQKDLDVRADQIIRD 77  Nitrobacter win...
P45292         2 KTLSEFIVERQAEYP-NAKGE-----LSGILSSIRLLAKIIHRDINKAGLTNILGQSGIENVQGESQMKLDLFAHNTMKA 75  Haemophilus inf...
2GQ1_A        76 ALKARDIVAGIASEEEDEIVVFe--GCEHAKYVVLXDPLDGSSNIDVNVSVGTIFSIYRr--------vTPvGTPVTeE- 144
Q05079        94 AMKASGNVKVLVSEEQEDLIVF---RNSPGKYAVCCDPIDGSSNLDAGVSVGTIVSLFKihenqngnsgEE-DSEGT-In 168 Kluyveromyces l...
P09201        95 AMRASGIIKVLVSEEQEDLIVF---PTNTGSYAVCCDPIDGSSNLDAGVSVGTIASIFRl---------LP-DSSGT-In 160 Saccharomyces c...
XP_002891265  87 ALVSSGRTSVLVSEEDEEATFVe--PSKRGKYCVVFDPLDGSSNIDCGVSIGTIFGIYTld--------hT-DEPTT-E- 153 Arabidopsis lyr...
XP_002820025  85 MLKSSFATCVLVSEEDKHAIIVe--PEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRkk--------sT-DEPSE-K- 151 Sumatran orangutan
Q328V4        76 ALKARDIVAGIASEEEDEIVVFe--GCEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRrv-------tPV-GTPVT-Ee 144 Shigella dysent...
P46283       143 ALQYSHVCKYACSEEVPELQDMg--GPVEGGFSVAFDPLDGSSIVDTNFTVGTIFGVWP-----------G-DKLTG-I- 206 thale cress
Q3SP44        78 ALGKQ-PIAALASEEMEELDIL----NPGAPICVAFDPLDGSSNINTNMSVGTIFSIMPtp--------sD-VNA----- 138 Nitrobacter win...
P45292        76 ALMAREEVAGFASEEEESFIAFdteRGRNAKYIILTDPLDGSSNIDVNVSVGTIFSIYRrv-------sPI-GSPVT-Le 146 Haemophilus inf...
2GQ1_A       145 DFLQPGNKQVAAGYVVYGSSTXLVYTTGC--GVHAFTYDPSLGVFCLCQE 192
Q05079       169 DVARCGREMVAACYTMYGASTHLVLTTGA--GVNGFTLDNNLGEFILTYP 216 Kluyveromyces lactis NRRL Y-1140
P09201       161 DVLRCGKEMVAACYAMYGSSTHLVLTLGD--GVDGFTLDTNLGEFILTHP 208 Saccharomyces cerevisiae S288C
XP_002891265 154 DVLKPGNEMVAAGYCMYGSSCMLVLSTGT--GVHGFTLDPSLGEFILTHP 201 Arabidopsis lyrata subsp. lyrata
XP_002820025 152 DALQPGRNLVAAGYALYGSATMLVLAMDC--GVNCFMLDPAIGEFILVDK 199 Sumatran orangutan
Q328V4       145 DFLQPGNKQVAAGYVVYGSSTMLVYTTGC--GVHAFTYDPSLGVFCLCQE 192 Shigella dysenteriae Sd197
P46283       207 ----TGGDQVAAAMGIYGPRTTYVLAVKGfpGTHEFLL-LDEGKWQHVKE 251 thale cress
Q3SP44       139 AFRQAGSEQLAAGFVVYGPQTSLVLTLGQ--GVDIFTLDRVDRVFKLTGS 186 Nitrobacter winogradskyi Nb-255
P45292       147 DFMQPGNKQVAAGYIVYGSSTMLVYTTGN--GVNGFTYDPSIGTFCLSHE 194 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap