Conserved Protein Domain Family
SDF

?
pfam00375: SDF 
Sodium:dicarboxylate symporter family
Statistics
?
PSSM-Id: 395299
View PSSM: pfam00375
Aligned: 87 rows
Threshold Bit Score: 193.889
Threshold Setting Gi: 123749948
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001631520    9 LVFLIFIGILLGFVIGFlvnsplknlrsdeDRKTNIMLIGFPGELFMNMLKLLMVPL-VVASVICALAALd-GRSSNRVS 86  starlet sea an...
Q838Q0          6 MITQIAIAVVVGILVGL-------------LIPASGNYLKIVGDVFLRLMQMAIPIL-ILGQIVQAVGSIn-PKELTSLG 70  Enterococcus f...
Q24PA1         16 LTTQIVIGTIGGIVFGA-------------LIGPWAANLKFLGDVWIRMLQMSMVPL-VMTAVAMAVGGTe-ARSVGKMG 80  Desulfitobacte...
Q183C8          7 LVPKLIIGIIVGILIGS-------------YAPEIIVQILVTVSTLFSAFLKFVIPFiIIGFVTAGIADL--ATGAGKLL 71  Clostridioides...
Q8RHH6          8 LVPRLIIAIIVGILIGQ-------------FLPLWIVRIFKTFSTFFGLFLSFFIPLmIVGYVVSGIAKL--TEGAGKLL 72  Fusobacterium ...
Q7MX88          8 LLPKIILAIVLGIGFGN-------------LFSFPFIRIFVTFNALFSELLGFSIPLiILGLVTVAIADI--GKGAGRML 72  Porphyromonas ...
Q2LQN6         19 FTLLLILSILVGSGLGI-------------LLKKDAALLKPLGDIFLNLLFTALVPL-VFFSIASAVAGMsnGRRLGKIL 84  Syntrophus aci...
EDK32492       14 LLGSIIIGAILGIFLG-----------------HKASVLKPFGDLFLNLMFMIIIPL-VFFSVTSAIANMkgMKRFGKII 75  Clostridium kl...
jgi:Geob_0422   9 FSLLLILSISAGLLLGs-------------fHPGAARAIRPLGDLFLNLLFMIIVPL-VFFTVSSSIAVSadSRRLTRTS 74  Geobacter dalt...
WP_033045089   12 spliLLGGIIAGAILGV-------------VLGEKATVFEPLGNIFINLMFTIVVPM-VFVSIATAVGSMlnMKRLGKIL 77  Clostridium bo...
XP_001631520   87 RRTFVYYLATTLLAVIIGVVLVTFMKPGsYGKPEG----------KGLKPSFYRPLDAVLD-LIRSCFPSNIITAAFMQq 155 starlet sea an...
Q838Q0         71 GRTIAVFGISSLAAALWGVLMAVIFNPG-YGVKMT----------GFQDASIKAQEISITD-TILNFVPKNIFDSLTQG- 137 Enterococcus f...
Q24PA1         81 ALAVKWILTFTLISTALGYVLGLIFQPG-VGVTII----------DPAQITEIPQASSFQD-TILSFFSTNIIGSMASG- 147 Desulfitobacte...
Q183C8         72 GITTGIAYGSTLIAGLLSFVVSTLIFPN---FIDA----------SVASQIGDPEAGMLAP-IFTIPLEPMV-------- 129 Clostridioides...
Q8RHH6         73 GFTAIVSYVSTIVAGTFSYMVAANLYPK---LISG----------ISSRINFEGKD--VAP-YFTIPLRPPI-------- 128 Fusobacterium ...
Q7MX88         73 LITVLIAYMATVLSGLFAYFAGNAFFPS---LISP----------GTGMSDVTQSQ-GVQP-YFSIAIPPMM-------- 129 Porphyromonas ...
Q2LQN6         85 SAMLAVFILTGTAASVLMVIGVSIYPPA---TGVH----------IELQSAGDIQQLKTSEqIVKAFTANDFNEILSKK- 150 Syntrophus aci...
EDK32492       76 GSTFIVFLFTALAASIIGIIGVFIVEPA---KGIDymalkqivsgSNDSLQQVKHVGVFQQ-IVNTITVSEFTSLFSKS- 150 Clostridium kl...
jgi:Geob_0422  75 SAMVIVFLATSLVAAVGALLFMLIVQPS---PGAG----------VVLKGQPVQEVPSLLAqLVKAFTASDFPELISRR- 140 Geobacter dalt...
WP_033045089   78 GSLMLTFVVTGCFAAVLVLVVVNIWSPA---ANTA----------IAMESAKVQESASISSmIVGSLTVDDFSGLMSRK- 143 Clostridium bo...
XP_001631520  156 rthytstaakvsyvnrtvnvhnmsqaelnsmrilsngthnytttpqairaasntvpdgskadsgenaNILGLLVFSLVFG 235 starlet sea an...
Q838Q0        138 -------------------------------------------------------------------SIIQIIVFALFFG 150 Enterococcus f...
Q24PA1        148 -------------------------------------------------------------------AMVACMVFSILFG 160 Desulfitobacte...
Q183C8        130 -------------------------------------------------------------------DVTAAIVFAFVMG 142 Clostridioides...
Q8RHH6        129 -------------------------------------------------------------------DVTAAIVFAFMMG 141 Fusobacterium ...
Q7MX88        130 -------------------------------------------------------------------SVMTALVLSFVLG 142 Porphyromonas ...
Q2LQN6        151 -------------------------------------------------------------------NMLALILFSILVG 163 Syntrophus aci...
EDK32492      151 -------------------------------------------------------------------NMLQLIVFSVLFG 163 Clostridium kl...
jgi:Geob_0422 141 -------------------------------------------------------------------SMLPLIVFSIGVG 153 Geobacter dalt...
WP_033045089  144 -------------------------------------------------------------------NMLPIIVFAIISG 156 Clostridium bo...
XP_001631520  236 AVLGRMGE--RG--VPLKALFESLNEVILKMLALVMW-FAPIGVCSLIAAQMAS-MEdiMGSLSMLGLYMATVIAGLLAH 309 starlet sea an...
Q838Q0        151 LALNKYLQ--SHpeTQLFQIIVDFNEVIITVIRYVMY-LAPLGIFALIASTISH-LG--LQIILPLVKYLLVYGLGTILF 224 Enterococcus f...
Q24PA1        161 LGMSAYTT--NSgdTSVINGVKALNACILNIIKIVMK-LAPIGVFCLLANAAGT-IG--FGIIIPMVKFYGAMLVGVIIQ 234 Desulfitobacte...
Q183C8        143 LGISALRNhgKG--ETLFNFFQEFQGIVTKTLSTVIIpLLPLYIAGTFANITIAgEV--WTILGVFWKVYLVVIPLHFVY 218 Clostridioides...
Q8RHH6        142 ITISVMRSqnKG--ETTFKLFGEYEEIITKVLAGFVIpLLPFHILGIFSEMAYSgIV--FKVLGVFLAIYLCIFAMHYVY 217 Fusobacterium ...
Q7MX88        143 LGLAGM----ES--RGMKGMMQDFQEIITKLIAKVIIpLLPIYIFGIFLNMTHQgEV--VKVLSVFLSIIGIIFGLHIIL 214 Porphyromonas ...
Q2LQN6        164 LATSSLKE--RG--RAFADFLTSASDVMMKVISFIMY-YAPVGLCAYFAYLTGV-FG--PDLLGSYFRAMSLYYPLTIFY 235 Syntrophus aci...
EDK32492      164 ISTAALGE--KA--ETVTKFFTAASRVMMEMVRIIMY-YAPIGLGCYFASVIGE-LG--PQILQGYLKVFILYIIISIIY 235 Clostridium kl...
jgi:Geob_0422 154 LATRSSKE--AG--ASFGRFLAGGAQVFIRMVDYVMY-AAPIGLLAWFAATVVD-TG--EALAAAYFNVFIVYYTFSAFY 225 Geobacter dalt...
WP_033045089  157 LAVSACGG--EE--SAVGKLLENLNRVIMRIVEMIMK-LAPIGLGAYFANLIGK-FG--PQLIGDYGRTMLIYYPMCLVY 228 Clostridium bo...
XP_001631520  310 aLFILPLLFIIATRR-NPLTF-ICGMRDALLTAFGTSSSTATLPCTIRCLEDRNRVDARISRFVLPLGSTVNMDGTALYE 387 starlet sea an...
Q838Q0        225 -LGIWILVITLYCKV-SPLRL-ITNMKNMSVMALATTSSAITLPVALEETEAKLGLSKRITNLVLPLGMSLNSNGSAMHM 301 Enterococcus f...
Q24PA1        235 fLIYFPLAAM-LCKI-SPLKM-PKKFAKMSVVALTTTSSAISLPTEMEDAVTKFGISRRVVDFVAPIGMSMNSTGAAQCY 311 Desulfitobacte...
Q183C8        219 mACQFTAAGVFSGK--NPVRM-LKNQVPGYLTAIGTQSSAATIPVNVGCAEKN-GVSKQIREFVVPLCATIHLSGSMISI 294 Clostridioides...
Q8RHH6        218 mLVMFSIAGGVSKR--NPFTL-IKNQIPAYFTAVGTQSSAATIPVNIQCGLKN-GTSPEIVDFVVPLCATIHLSGSMITL 293 Fusobacterium ...
Q7MX88        215 lIFQYSVAGFIAKK--NPFRM-LWRMLPAYFTALGTQSSAATIPVTLKSAVKC-GVSEEIAGFTIPLCATIHLSGSTLKI 290 Porphyromonas ...
Q2LQN6        236 fFTGFTIYAYLAGKG-RGVRTfWKNIIPPALTALATGSSVATIPSNLEAANR-SGVPKDISELIIPIGATIHMDGSCLAA 313 Syntrophus aci...
EDK32492      236 yFGFFTLYAFLAGGK-NAIKIfWKNAAVPTITALATCSSAASIPVNLEFTKK-MGVPKDVTETVIPLGANIHKDGSVIGG 313 Clostridium kl...
jgi:Geob_0422 226 fVAGFSLYAFLAGGVvAVRRF-WAHMLEPSLTALGTCSSMATMPVNLEAAPK-MGVPQGISDVVIPVGAALHKDGSVIGG 303 Geobacter dalt...
WP_033045089  229 gMVFYPAYTYFAGGRlGVKKM-LQNILDPAVTSFATQSSVATLPVNMKACKN-IGVPEDIYNIVLPMGATMHMDGSVISS 306 Clostridium bo...
XP_001631520  388 VVAAVFIAQIHGIELG-LDDLAITCLTATAASIGASGIPQAGLVT-MVMVLTAVNLPT-ED-IGLILSVDWFIDRIRTTV 463 starlet sea an...
Q838Q0        302 AFTVMTIAQMYQLEFD-ITKMIYLAITATFVSLANAVVPGAGLVS-LAVIVPQMGLPI-ES-IAIFAGVEWFVGMLRTIL 377 Enterococcus f...
Q24PA1        312 ILVILFLSQASGVVLS-PMQIGLAVLLSVLMSTGNVGIPGATVVT-YTFLAASMGLPL-DG-IALLLGIDWFVGQLRTVL 387 Desulfitobacte...
Q183C8        295 TGFTTAVLMMNGMPHG-IGVLFPYIAMLGIAMVAAPGAPGGAIMSaLPFLP-MVGIPSdGGlASLMIALYLTQDSFGTAC 372 Clostridioides...
Q8RHH6        294 TSCIMGVLLLNGMPHS-LGMMFPFLCMLGIAMVAAPGAPGGAVMSaLPFLF-LIGIDAqGSlGSLLIALYITQDSFGTAI 371 Fusobacterium ...
Q7MX88        291 TCCALALMIMQGMPYD-AGLFTGFIFMLGITMVAAPGVPGGAIMAaLGVLQSMLGFd--ESlQALMIALYITMDNFGTAC 367 Porphyromonas ...
Q2LQN6        314 VLKIAFLFGIFQMDFSgPGTLLTAVGIALLSGTVMSGIPGGGFIG-ELLIISLYGFPL-EA-FPIISMIGVLVDPPATMV 390 Syntrophus aci...
EDK32492      314 VMKIAFLFGLLNKNMAsISSVLSIIFISFLVGAVMAAIPSGGMIG-EMLILSIYGFSQ-GL-LPIIMVISVIIDAPATVL 390 Clostridium kl...
jgi:Geob_0422 304 VLKILFAMSLFHQELT-FSRLIVVVGVAILVGVVMGAIPSGGMIG-EMLILSVFGFPP-ET-LPLLAAISVIIDPLATLL 379 Geobacter dalt...
WP_033045089  307 ITKIAFLFGVFKMPFTgMGTYAMAVLVSILSAFVLSGAPGGGLVG-EMLIVSFFGFPG-EA-FPLIATIGFLVDPAATCL 383 Clostridium bo...
XP_001631520  464 NVLGDAIGAGIVEHL 478 starlet sea anemone
Q838Q0        378 NVNSDVYSAILVAKS 392 Enterococcus faecalis
Q24PA1        388 NVDVDVLIALLVANK 402 Desulfitobacterium hafniense Y51
Q183C8        373 NVSGDNAIAVVVDKI 387 Clostridioides difficile 630
Q8RHH6        372 NVSGDNAIAIYVDEF 386 Fusobacterium nucleatum subsp. nucleatum
Q7MX88        368 NVTGDGAISLIVDKL 382 Porphyromonas gingivalis
Q2LQN6        391 NATGDNVCSMIAARI 405 Syntrophus aciditrophicus SB
EDK32492      391 NSTGNTVCSMMISRL 405 Clostridium kluyveri DSM 555
jgi:Geob_0422 380 NATGDNVAAMLVTRL 394 Geobacter daltonii FRC-32
WP_033045089  384 NSSGDTIASMIIARf 398 Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap