6FL5,3N0L,1EQB,6R8F


Conserved Protein Domain Family
SHMT

?
pfam00464: SHMT 
Click on image for an interactive view with Cn3D
Serine hydroxymethyltransferase
Statistics
?
PSSM-Id: 395372
Aligned: 10 rows
Threshold Bit Score: 653.355
Threshold Setting Gi: 296863744
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6FL5_J  16 LKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYK 95  human
3N0L_B   6 LEXFDKEIFDLTNKELERQCEGLEXIASENFTLPEVXEVXGSILTNKYAEGYPGKRYYGGCEFVDEIETLAIERCKKLFN 85  Campylobacter jejuni
P39148   4 LPAQDEQVFNAIKNERERQQTKIELIASENFVSEAVMEAQGSVLTNKYAEGYPGKRYYGGCEHVDVVEDIARDRAKEIFG 83  Bacillus subtilis sub...
P24060  18 LDQADPEIAAAIKGELGRQRHEVELIASENIVSRAVLEAQGSVMTNKYAEGYPGARYYGGCEWVDVAENLAIDRAKKLFG 97  Bradyrhizobium diazoe...
1EQB_B   8 IADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYFGGCEYVDIVEQLAIDRAKELFG 87  Escherichia coli
6R8F_K  49 LSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFD 128 human
P50433  56 lEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFR 135 potato
P37292  33 VSEGDPEMFDILQQERHRQKHSITLIPSENFTSKAVMDLLGSELQNKYSEGYPGERYYGGNEIIDKSESLCQARALELYG 112 Saccharomyces cerevis...
P37291  17 LVDTDPEVDSIIKDEIERQKHSIDLIASENFTSTSVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFH 96  Saccharomyces cerevis...
P34898  18 LVESDPQVAEIMKKEVQRQRESIILIASENVTSRAVFDALGSPMSNKYSEGLPGARYYGGNQHIDEIEVLCQNRALEAFH 97  Neurospora crassa OR74A
6FL5_J  96 LDpqcwGVNVQPYSGSPANFAVYTALVEPNGAIMGLDLPDGGHLTHGFMTDKkki-saTSIFFNSMPYKVNpDTGYINYD 174 human
3N0L_B  86 CK----FANVQPNSGSQANQGVYAALINPGDKILGXDLSHGGHLTHGAKVSS------SGKXYESCFYGVE-LDGRIDYE 154 Campylobacter jejuni
P39148  84 AE----HVNVQPHSGAQANMAVYFTILEQGDTVLGMNLSHGGHLTHGSPVNF------SGVQYNFVEYGVDkETQYIDYD 153 Bacillus subtilis sub...
P24060  98 AG----FANVQPNSGSQMNQAVFLALLQPGDTFMGLDLAAGGHLTHGSPVNM------SGKWFKAAHYTVRrEDQIIDMD 167 Bradyrhizobium diazoe...
1EQB_B  88 AD----YANVQPHSGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHGSPVNF------SGKLYNIVPYGID-ATGHIDYA 156 Escherichia coli
6R8F_K 129 LDpaqwGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVkri-saTSIFFESMPYKLNpKTGLIDYN 207 human
P50433 136 LDpakwGVNVQPLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTkki-saVSIFFETMPYRLDeSTGYIDYD 214 potato
P37292 113 LDpakwGVNVQPLSGAPANLYVYSAIMNVGERLMGLDLPDGGHLSHGYQLKSgtpisfISKYFQSMPYHVDhTTGLIDYD 192 Saccharomyces cerevis...
P37291  97 VTpdkwGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENrki-saVSTYFESFPYRVNpETGIIDYD 175 Saccharomyces cerevis...
P34898  98 LDpkqwGVNVQCLSGSPANLQVYQAIMPVHGRLMGLDLPHGGHLSHGYQTPQrki-saVSTYFETMPYRVNiDTGLIDYD 176 Neurospora crassa OR74A
6FL5_J 175 QLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRA 254 human
3N0L_B 155 KVREIAKKEKPKLIVCGASAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAGEHPSPFPYAHVVSSTTHKTLRGPRG 234 Campylobacter jejuni
P39148 154 DVREKALAHKPKLIVAGASAYPRTIDFKKFREIADEVGAYFMVDMAHIAGLVAAGLHPNPVPYADFVTTTTHKTLRGPRG 233 Bacillus subtilis sub...
P24060 168 AVQKQAEEIKPKLIVAGGSAYSRAWDFKRFREIADSVGAYLLVDMAHFAGLVAGGVHASPVPYAHVTTTTTHKSLRGPRG 247 Bradyrhizobium diazoe...
1EQB_B 157 DLEKQAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRG 236 Escherichia coli
6R8F_K 208 QLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGTRS 287 human
P50433 215 QLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCNKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRG 294 potato
P37292 193 NLQVLAKAFRPKVIVAGTSAYSRLIDYARFKEISQGCGAYLMSDMAHISGLVAANVVPSPFEHSDIVTTTTHKSLRGPRG 272 Saccharomyces cerevis...
P37291 176 TLEKNAILYRPKVLVAGTSAYCRLIDYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRG 255 Saccharomyces cerevis...
P34898 177 TLEKNAQLFRPKVLVAGTSAYCRLIDYERMRKIADSVGAYLVVDMAHISGLIASEVIPSPFLYADVVTTTTHKSLRGPRG 256 Neurospora crassa OR74A
6FL5_J 255 GMIFYRkgvksvdpktgkEilYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTE 334 human
3N0L_B 235 GIIXTN------------D--EELAKKINSAIFPGIQGGPLXHVIAAKAVGFKFNLSDEWKVYAKQVRTNAQVLANVLXD 300 Campylobacter jejuni
P39148 234 GMILCR---------------EEFGKKIDKSIFPGIQGGPLMHVIAAKAVSFGEVLQDDFKTYAQNVISNAKRLAEALTK 298 Bacillus subtilis sub...
P24060 248 GLILSN------------D--ETLAKKLNSAIFPGLQGGPLMHVIAAKAVAFGEALRPDFKVYAKNVVENAKALAEAMKS 313 Bradyrhizobium diazoe...
1EQB_B 237 GLILAK------------GgsEELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLE 304 Escherichia coli
6R8F_K 288 GLIFYRkgvkavdpktgrEipYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLE 367 human
P50433 295 AMIFYRkgvkev-nkqgkEvfYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNSSKFAQALGE 373 potato
P37292 273 AMIFFRkgiksv-tkkgkEipYELEKKINFSVFPGHQGGPHNHTIGAMAVALKQAMSPEFKEYQQKIVDNSKWFAQELTK 351 Saccharomyces cerevis...
P37291 256 AMIFFRrgvrsinpktgkEvlYDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEFKEYQTQVLKNAKALESEFKN 335 Saccharomyces cerevis...
P34898 257 AMIFFRrgvrsvdaktgkEtlYDLEDKINFSVFPGHQGGPHNHTITALAVALKQAASPEFKEYQQKVVANAKALEKKLKE 336 Neurospora crassa OR74A
6FL5_J 335 LGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGD-RSALRPSGLRLGTPALTSRGLLEKDFQKVAH 413 human
3N0L_B 301 RKFKLVSDGTDNHLVLXSFLDREFSGKDADLALGNAGITANKNTVPGEiRSPFITSGLRLGTPALTARGFKEKEXEIVSN 380 Campylobacter jejuni
P39148 299 EGIQLVSGGTDNHLILVDLRSLGLTGKVAEHVLDEIGITSNKNAIPYDpEKPFVTSGIRLGTAAVTSRGFDGDALEEVGA 378 Bacillus subtilis sub...
P24060 314 HGFDIVSGGTDNHLMLVDLRPKGLKGNVSEKALVRAAITCNKNGIPFDpEKPFVTSGLRLGTPAATTRGFGVAEFQQVGG 393 Bradyrhizobium diazoe...
1EQB_B 305 RGYKVVSGGTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDpKSPFVTSGIRVGTPAITRRGFKEAEAKELAG 384 Escherichia coli
6R8F_K 368 RGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGD-RSAITPGGLRLGAPALTSRQFREDDFRRVVD 446 human
P50433 374 KGYELVSGGTDNHLVLVNMKNKGIDGSRVEKVLEAVHIAANKNTVPGD-VSAMVPGGIRMGTPALTSRGFLEEDFVKVAD 452 potato
P37292 352 MGYKLVSGGTDNHLIVIDLSGTQVDGARVETILSALNIAANKNTIPGD-KSALFPSGLRIGTPAMTTRGFGREEFSQVAK 430 Saccharomyces cerevis...
P37291 336 LGYRLVSNGTDSHMVLVSLREKGVDGARVEYICEKINIALNKNSIPGD-KSALVPGGVRIGAPAMTTRGMGEEDFHRIVQ 414 Saccharomyces cerevis...
P34898 337 LGYKLVSDGTDSHMVLVDLRPIGVDGARVEFLLEQINITCNKNAVPGD-KSALTPGGLRIGTPAMTSRGFGEADFEKVAV 415 Neurospora crassa OR74A
6FL5_J 414 FI 415 human
3N0L_B 381 YI 382 Campylobacter jejuni
P39148 379 II 380 Bacillus subtilis subsp. subtilis str. 168
P24060 394 MI 395 Bradyrhizobium diazoefficiens USDA 110
1EQB_B 385 WM 386 Escherichia coli
6R8F_K 447 FI 448 human
P50433 453 Ff 454 potato
P37292 431 YI 432 Saccharomyces cerevisiae S288C
P37291 415 YI 416 Saccharomyces cerevisiae S288C
P34898 416 FV 417 Neurospora crassa OR74A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap