6E1K,3J9P,6CUD,6PUR,6O20,5H3O,6E1K,5XSY,6AGF,5XSY,5XSY,3JBR,5XSY


Conserved Protein Domain Family
Ion_trans

?
pfam00520: Ion_trans 
Click on image for an interactive view with Cn3D
Ion transport protein
This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.
Statistics
?
PSSM-Id: 395416
View PSSM: pfam00520
Aligned: 243 rows
Threshold Bit Score: 55.736
Threshold Setting Gi: 38503232
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6E1K_A        93 DRDYYYLGELPYLTNAESIIY-----------------------------------------EVITLAILLVHTFFPISY 131 thale cress
O73606       216 GKIFACISISFVAITAVSLCIstmpdvreeedrg----------------ecsqkcydifvlETVCVAWFSFEFLLRSIQ 279 chicken
XP_012367187 226 GKVFACLSVLFVTVTAVNLSVstlpslreeeeqg----------------hcsqmchnvfivESVCVGWFSLEFLLRLIQ 289 northern white-...
P97557       212 ARIFGVISIIFVAVSIVNMALmsaelswl-------------------------nlqlleilEYVCISWFTGEFILRFLC 266 Norway rat
Q9BQ31       184 AKLIAISSLSVVLASIVAMCVhsmsefqnedg--------------------evddpvlegvEIACIAWFTGELAVRLAA 243 human
O35173       188 SKLFSCVSIGVVLASIAAMCIhslpeyqareaaaavaav-----aagrsaeevrddpvlrrlEYFCIAWFSFEVSSRLLL 262 house mouse
O35174       186 SRVFSVLSILVVLGSIITMCLnslpdfqipdsq-----------------gnpgedprfeivEHFGIAWFTFELVARFAV 248 house mouse
Q26094       173 AKIFAILSVVIIVVSLIMFVIetlpvfapkelltnngt--------iyktvysehatwmftvNTAVICWFTIEFILRLIC 244 penicillate jel...
O76457       173 AKIIAVISVFFIVISILSFCLkthpemrvpvlknatsrtvngtytwrlekketepheaffyiECASNAWFTFEIIIRFVV 252 California sea ...
P17972       173 AKTIGVVSVFFICISILSFCLkthpdmrvpivrnitvktangsngwfldktqtnahiaffyiECVCNAWFTFEILVRFIS 252 fruit fly
6E1K_A       132 EGS-RIFWTSRLNLVKVACVVILFVDVlvd---------flyLSp---------------------lAFDFLPFRIAPYV 180 thale cress
O73606       280 AENkCAFLKTPLNIIDILAILPFYISL---------------IVdmastknsskpgggagnkylervGLVLRFLRALRIL 344 chicken
XP_012367187 290 APSkFAFLRSPLTLIDLVAILPYYITL---------------LVdgaaagrrkp---gagnsyldkvGLVLRVLRALRIL 351 northern white-...
P97557       267 VKDrCHFLRKVPNIIDLLAILPFYITLlveslsgshttqeleNV-----------------------GRLVQVLRLLRAL 323 Norway rat
Q9BQ31       244 APCqKKFWKNPLNIIDFVSIIPFYATL---------------AVdtkeees----------edienmGKVVQILRLMRIF 298 human
O35173       263 APStRNFFCHPLNLIDIVSVLPFYLTL---------------LAgaalgdqrg-----asgeelgdlGKVVQVFRLMRIF 322 house mouse
O35174       249 APDfLKFFKNALNLIDLMSIVPFYITL---------------VVnlvvess----------ptlanlGRVAQVLRLMRIF 303 house mouse
Q26094       245 CPNkIKFFLNTGNIIDFLSILPYYLSLvl-----------vsSS-----------------------KGSFSMLRVIRVL 290 penicillate jel...
O76457       253 APNkLDFLKAPVNIIDIVATLSFYLDFmlt---------elkQE-----------------------SDMLEFFSIIRIM 300 California sea ...
P17972       253 SPNkWEFIKSSVNIIDYIATLSFYIDL---------------VLqrfas--------------hlenADILEFFSIIRIM 303 fruit fly
6E1K_A       181 RVIIFILSIRELRDTLVLLSGMLGTYLNILALWMLFLLFASWIA-FVMF--ENTQQGLTV-FTSYGATLYQMFILFTTSN 256 thale cress
O73606       345 YVMRLARHSLGLQTLGLTVRRCTREFGLLLLFLCVAMALFSPLVyl----aESELGAKQE-FTSIPTSYWWAVISMTTVG 419 chicken
XP_012367187 352 YVMRLARHSLGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLL-YVIE---NEMADSPE-FTSIPACYWWAVITMTTVG 426 northern white-...
P97557       324 RMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGISIFSTIE-YFAE----QSIPDTT-FTSVPCAWWWATTSMTTVG 397 Norway rat
Q9BQ31       299 RILKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLI-YSVE-----KDDHTSsLTSIPICWWWATISMTTVG 372 human
O35173       323 RVLKLARHSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVA-YTAEeeNEG-------FHTIPACWWWGTVSMTTVG 394 house mouse
O35174       304 RILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVA-YTIE-----KEENEG-LATIPACWWWATVSMTTVG 376 house mouse
Q26094       291 RVFKLSRHSRGLQILGNTLKASFNELMMLAFFLFVMILIFGSCVyYAEY-----KEPGTK-FISIPSSFWWAIVTMTTVG 364 penicillate jel...
O76457       301 RLCKLTRHSAGLKILIHTFKASAKELILLIFFLVLGIVIFAALI---YYaeriqYNPEND-FESIPVGLWWAIVTMTTVG 376 California sea ...
P17972       304 RLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLV---YYaeriqPNPHND-FNSIPLGLWWALVTMTTVG 379 fruit fly
6E1K_A       257 NPDVWIPAYKSSrwssvFFVLYVLIGVYFVTNLILAVVYDSFKEQLAKQV 306 thale cress
O73606       420 YGDMVPRSIPGQ-----VVALSSILSGILLMAFPVTSIFHTFSRSYSELK 464 chicken
XP_012367187 427 YGDMVPRSTPGQ-----VVALSSILSGILLMAFPVTSIFHTFSRSYLELK 471 northern white-cheeked gibbon
P97557       398 YGDIRPDTTTGK-----IVAFMCILSGILVLALPIAIINDRFSACYFTLK 442 Norway rat
Q9BQ31       373 YGDTHPVTLAGK-----LIASTCIICGILVVALPITIIFNKFSKYYQKQK 417 human
O35173       395 YGDVVPETVGGK-----LAASGCILGGILVVALPITIIFNKFSHFYRRQK 439 house mouse
O35174       377 YGDVVPGTTAGK-----LTASACILAGILVVVLPITLIFNKFSHFYRRQK 421 house mouse
Q26094       365 YGDMHPVTFWGQ-----IVGSMAVVCGVLTIALPVPVVVSNFEYFYTKER 409 penicillate jellyfish
O76457       377 YGDMAPKTYVGM-----FVGALCALAGVLCIALPVPVIVSNFALFYSHTQ 421 California sea hare
P17972       380 YGDMAPKTYIGM-----FVGALCALAGVLTIALPVPVIVSNFAMYYSHTQ 424 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap