1CS1,1IBJ,1N8P,5TT2,3NDN,2FQ6,1PFF,1E5E,4L0O


Conserved Protein Domain Family
Cys_Met_Meta_PP

?
pfam01053: Cys_Met_Meta_PP 
Click on image for an interactive view with Cn3D
Cys/Met metabolism PLP-dependent enzyme
This family includes enzymes involved in cysteine and methionine metabolism. The following are members: Cystathionine gamma-lyase, Cystathionine gamma-synthase, Cystathionine beta-lyase, Methionine gamma-lyase, OAH/OAS sulfhydrylase, O-succinylhomoserine sulfhydrylase All of these members participate is slightly different reactions. All these enzymes use PLP (pyridoxal-5'-phosphate) as a cofactor.
Statistics
?
PSSM-Id: 395837
Aligned: 25 rows
Threshold Bit Score: 477.11
Threshold Setting Gi: 127027
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1CS1_B                 6 ATIAVRSGLNDDE--QYGCVVPPIHLSSTYNFT--------GFNEPRA-HDYSRRGNPTRDVVQRALAELEGGAGAVLTN 74  Escheri...
P55217               176 GSLTVHAGERLGRgiVTDAITTPVVNTSAYFFKktaelidfKEKRSVS-FEYGRYGNPTTVVLEDKISALEGAESTLVMA 254 thale c...
instpast:LEPBI_I1593   8 ETIALHGGQEPDP--TTTSRAVPLYQTTSYVFKdtdhaarlFGLQEFG-NIYTRLMNPTTDVLEKRVAALEGGVAALATA 84  Leptosp...
P50125                10 ETLQLHAGQEPDP--ATNSRAVPIYATTSYTFNdsahgarlFGLKEFG-NIYSRIMNPTVDVFEKRIAALEGGVAAVAAS 86  Aspergi...
P55218                20 DTLAVRAGQRr---tPEGEHGEALFTTSSYVFRtaadaaarFAGEVPG-NVYSRYTNPTVRTFEERIAALEGAEQAVATA 95  Pseudom...
3NDN_A                28 aTVGVRGGMLRs---GFEETAEAMYLTSGYVYGsaavaeksFAGELDH-YVYSRYGNPTVSVFEERLRLIEGAPAAFATA 103 Mycobac...
O02215                69 STSHAKPLSNADP------VVVPIYHSSTYRFKtvd---qfNEDNHGAnFVYRRCGNPTTENVEVVINEIEGGAGSLLYN 139 Caenorh...
2FQ6_A                27 DTQLVNAGRSKKy--TLGAVNSVIQRASSLVFDsveakkhaTRNRANGeLFYGRRGTLTHFSLQQAMCELEGGAGCVLFP 104 Escheri...
1PFF_A                 1 ------------------------------------------------------------SALEGKIAKLEHAEACAATA 20  Trichom...
1E5E_B                 9 ATACIHANPQKD---QFGAAIPPIYQTSTFVFDncqqggnrFAGQESG-YIYTRLGNPTVSNLEGKIAFLEKTEACVATS 84  Trichom...
1CS1_B                75 TGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQ----GDEQALRAALAE-KPKLVLVESPSNP 149 Escheri...
P55217               255 SGMCASTVMLLALVPAGGHIVTTTDCYRKTRIFMENFLPKLGITVTVIDP----ADIAGLEAAVNEfKVSLFFTESPTNP 330 thale c...
instpast:LEPBI_I1593  85 SGQSAEMLALLNIVEAGQEIVASSSLYGGTYNLLHYTFPKLGIKVHFVDP----SNPENFKKASND-KTRAFYAETLGNP 159 Leptosp...
P50125                87 SGQAAQFMAISALAHAGDNIVSTSNLYGGTYNQFKVLFPRLGITTKFVQG----DKAEDIAAAIDD-RTKAVYVETIGNP 161 Aspergi...
P55218                96 SGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFKRFGIQVDYPPL----SDLAAWEAACKP-NTKLFFVESPSNP 170 Pseudom...
3NDN_A               104 SGMAAVFTSLGALLGAGDRLVAARSLFGSCFVVCSEILPRWGVQTVFVDG----DDLSQWERALSV-PTQAVFFETPSNP 178 Mycobac...
O02215               140 SGLAAISAVFLEFLSSGAHMIVMNPIYSGTSSFINETLARFGVEITSVDVekekDFAGAVEKAIRP-NTKMIYFESIANP 218 Caenorh...
2FQ6_A               105 CGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDP----LIGADIVKHLQP-NTKIVFLESPGSI 179 Escheri...
1PFF_A                21 SGMGAIAASVWTFLKAGDHLISDDCLYGCTHALFEHQLRKFGVEVDFIDM----AVPGNIEKHLKP-NTRIVYFETPANP 95  Trichom...
1E5E_B                85 SGMGAIAATVLTILKAGDHLISDECLYGCTHALFEHALTKFGIQVDFINT----AIPGEVKKHMKP-NTKIVYFETPANP 159 Trichom...
1CS1_B               150 LLRVVDIAKICHLAREVG--AVSVVDNTFLSP-ALQNPLALGADLVLHSCTXYLNGHSDVVAGVVIAKD-PDVVTELAW- 224 Escheri...
P55217               331 FLRCVDIELVSKICHKRG--TLVCIDGTFATP-LNQKALALGADLVVHSATKYIGGHNDVLAGCIC--GsLKLVSEIRN- 404 thale c...
instpast:LEPBI_I1593 160 KLDTLDIAAVSKVAKEVG--VPLVIDNTMPSP-FLVNPLKHGADIVVHSLTKFLGGHGTSIGGIIIDGGsFNWGNG-KF- 234 Leptosp...
P50125               162 RYNVPDFEVIAKVAHEKG--IPLVVDNTFGAGgYFVRPIEHGADIVVHSATKWIGGHGTTIGGVVVDSGkFDWGKNAAR- 238 Aspergi...
P55218               171 LAELVDIAALAEIAHAKg--ALLAVDNCFCTP-ALQQPLKLGADVVIHSATKYIDGQGRGMGGVVA--GrGEQMKevv-- 243 Pseudom...
3NDN_A               179 MQSLVDIAAVTELAHAAG--AKVVLDNVFATP-LLQQGFPLGVDVVVYSGTXHIDGQGRVLGGAIL-GDrEYIDGPVQK- 253 Mycobac...
O02215               219 TMAVPDILGTIEVAKKYK--ILTCLDATFSSP-YNIQPLKLGADISLHSCSKYIGGHTDVIAGVVTVSSyDNWKK-LKL- 293 Caenorh...
2FQ6_A               180 TMEVHDVPAIVAAVRSVVpdAIIMIDNTWAAG-VLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVCNArCWEQLREN-- 256 Escheri...
1PFF_A                96 TLKVIDIEDAVKQARKQKd-ILVIVDNTFASP-ILTNPLDLGVDIVVHSATKYINGHTDVVAGLVC--SrADIIAKvksq 171 Trichom...
1E5E_B               160 TLKIIDMERVCKDAHSQEg-VLVIADNTFCSP-MITNPVDFGVDVVVHSATKYINGHTDVVAGLICGKA--DLLQQIRMv 235 Trichom...
1CS1_B               225 -WA---------------------------------------NNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVK 264 Escheri...
P55217               405 -LH---------------------------------------HVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAE 444 thale c...
instpast:LEPBI_I1593 235 -KNftepdpsyhglkfwdvfgkfepfggvniafilkarvqglRDLGPAISPFNAWQILQGVETLPLRMERHSHNALKVAE 313 Leptosp...
P50125               239 -FPqftqpsegyhglnfwe-------tfgpiafairvrveilRDLGSALNPFAAQQLILGLETLSLRAERHASNALALAN 310 Aspergi...
P55218               244 ---------------------------------------gflRTAGPTLSPFNAWLFLKGLETLRIRMQAHSASALALAE 284 Pseudom...
3NDN_A               254 -LM---------------------------------------RHTGPAMSAFNAWVLLKGLETLAIRVQHSNASAQRIAE 293 Mycobac...
O02215               294 -QQ---------------------------------------LTTGSSLSPYDAALLTRGLKTLGLRVDRISENAQKTAE 333 Caenorh...
2FQ6_A               257 -A----------------------------------------YLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAE 295 Escheri...
1PFF_A               172 ---------------------------------------gikDITGAIISPHDAWLITRGTLTLDMRVKRAAENAQKVAE 212 Trichom...
1E5E_B               236 gIK---------------------------------------DITGSVISPHDAWLITRGLSTLNIRMKAESENAMKVAE 276 Trichom...
1CS1_B               265 YLQTQPLVKKLYHPSLPENQGHEIAARQQKGFgA--MLSFELDGDE----QTLRRFLGGLSLFTLAESLGGVESLISHAA 338 Escheri...
P55217               445 ILEAHPKVSHVYYPGLPSHPEHELAKRQMTGFgG--VVSFEIDGDI----ETTIKFVDSLKIPYIAPSFGGCESIVDQPA 518 thale c...
instpast:LEPBI_I1593 314 FLQKHPKVEWVNYPGLPTDKNYATAKKYHERGlFgaIVGFEIKGGV----EKAKKFIDGLELFSLLANIGDAKSLAIHPA 389 Leptosp...
P50125               311 WLKKNDHVSWVSYVGLEEHSSHEVAKKYLKRG-FggVLSFGVKGEAa----vGSQVVDNFKLISNLANVGDSKTLAIHPW 385 Aspergi...
P55218               285 WLERQPGIERVYYAGLPSHPQHELARRQQSGFg--aVVSFDVKGGRdaa----wrFIDATRMVSITTNLGDTKTTIAHPA 358 Pseudom...
3NDN_A               294 FLNGHPSVRWVRYPYLPSHPQYDLAKRQMSGGgT--VVTFALDCPEdvakQRAFEVLDKMRLIDISNNLGDAKSLVTHPA 371 Mycobac...
O02215               334 FLESHPKVERVFYPGLPSHPQHQYAKQVMKQFaG--MIAFDVGTA-----ENAIKLVESLKLIIHAVSLGGTESLIEHPL 406 Caenorh...
2FQ6_A               296 WLAEHPQVARVNHPALPGSKGHEFWKRDFTGSsG--LFSFVLKKKLn--nEELANYLDNFSLFSMAYSWGGYESLILANQ 371 Escheri...
1PFF_A               213 FLHEHKAVKKVYYPGLPDHPGHEIAKKQMKMFg--sMIAFDVD-GLe----kAKKVLDNCHVVSLAVSLGGPESLIQHPA 285 Trichom...
1E5E_B               277 YLKSHPAVEKVYYPGFEDHEGHDIAKKQMRMYgS--MITFILKSGF----EGAKKLLDNLKLITLAVSLGGCESLIQHPA 350 Trichom...
1CS1_B               339 TMTHAGMAPEARAAAGISETLLRISTGIEDGEDLIADLENGFR 381 Escherichia coli
P55217               519 IMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALE 561 thale cress
instpast:LEPBI_I1593 390 STTHQQLTSEEQISAGVTPGFVRLSVGLENLDDILVDLEEALK 432 Leptospira biflexa serovar Patoc strain 'Pat...
P50125               386 STTHEQLTDQERIDSGVTEDAIRISVGTEHIDDIIADFEQSFA 428 Aspergillus nidulans FGSC A4
P55218               359 TTSHGRLSPEDRARAGIGDSLIRVAVGLEDLDDLKADMARGLA 401 Pseudomonas aeruginosa PAO1
3NDN_A               372 TTTHRAMGPEGRAAIGLGDGVVRISVGLEDTDDLIADIDRALs 414 Mycobacterium tuberculosis
O02215               407 SMSHGKHLLRYLDGPTVAPGLLRFSVGIENVEDIIGDLNDALE 449 Caenorhabditis elegans
2FQ6_A               372 PEHIAAIRPQGEIDFSG--TLIRLHIGLEDVDDLIADLDAGFA 412 Escherichia coli
1PFF_A               286 SMTHAGVPKEEREAAGLTDNLIRLSVGCENVQDIIDDLKQALD 328 Trichomonas vaginalis
1E5E_B               351 SMTHAVVPKEEREAAGITDGMIRLSVGIEDADELIADFKQGLd 393 Trichomonas vaginalis G3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap