2VYC,5FKZ,3Q16


Conserved Protein Domain Family
OKR_DC_1

?
pfam01276: OKR_DC_1 
Click on image for an interactive view with Cn3D
Orn/Lys/Arg decarboxylase, major domain
Statistics
?
PSSM-Id: 396025
Aligned: 8 rows
Threshold Bit Score: 487.011
Threshold Setting Gi: 118334
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2VYC_D 140 PPLFSALMKYSDIHEYSWAAPGHQGGVGFTKTPAGRFYHDYYGENLFRTDMGIERTSLGSLLDHTGAFGESEKYAARVFG 219 Escherichia coli BL21...
P44317 108 PPFFKMLSEYVEMGNIAFDCPGHQGGQYYRKHPAGRFLYDFYGENIFRSDICNADVKLGDLLIHEGAACDAQKYAAQVFN 187 Haemophilus influenza...
P21169 101 PPFYDTLTQYVEMGNSTFACPGHQHGAFFKKHPAGRHFYDFFGENVFRADMCNADVKLGDLLIHEGSAKDAQKFAAKVFH 180 Escherichia coli K-12
P37536   3 TPLYKALIQHARRNSHSFHVPGHHNGDVFFDD-AKSIF-----DPLLTIDV-TELAGLDDLHHPSGVIKEAQELASQLYG 75  Bacillus subtilis sub...
P21885   6 TPLYTGLKKHASRQPVQFHIPGHKKGAGMDPE-----FRQFIGENALSIDL-INIEPLDDLHAPKGIIKQAQDLAAEAFG 79  Bacillus subtilis sub...
P24169 109 PPFFRALVDYVNQGNSAFDCPGHQGGEFFRRHPAGNQFVEYFGEALFRADLCNADVAMGDLLIHEGAPCIAQQHAAKVFN 188 Escherichia coli K-12
5FKZ_E 130 PPFTKALFTYVKERKYTFCTPGHMGGTAYQKSPVGCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFG 209 Escherichia coli K-12
3Q16_C 130 PPLTKALFKYVREGKYTFCTPGHMGGTAFQKSPVGSLFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEAEQYIARVFN 209 Escherichia coli K-12
2VYC_D 220 ADRSWSVVVGTSGSNRTIMQACMTDNDVVVVDRNCHKSIEQ-GLMLTGAKPVYMVPS-RNRYGIIGPIYPQEMQPETLQK 297 Escherichia coli BL21...
P44317 188 ADKTYFVLNGTSSSNKVALNAVLAPGDLVLFDRNNHKSNHHgALIQAGATPIYLETA-RNPFGFIGGIDSHCFEEDYLKS 266 Haemophilus influenza...
P21169 181 ADKTYFVLNGTSAANKVVTNALLTRGDLVLFDRNNHKSNHHgALIQAGATPVYLEAS-RNPFGFIGGIDAHCFNEEYLRQ 259 Escherichia coli K-12
P37536  76 SAESFFLVNGTTVGNLAMILSVCEPGDTILVQRNCHKSVFH-AVDLSGAEPVYLAPDvDSAMHVPTHVPL-----GTIKE 149 Bacillus subtilis sub...
P21885  80 ADHTFFSVQGTSGAIMTMVMAVCGPGDKIIIPRNVHKSIMT-AIVFSGAVPIFIHPEiDNELGISHGITL-----ESAKR 153 Bacillus subtilis sub...
P24169 189 ADKTYFVLNGTSSSNKVVLNALLTPGDLVLFDRNNHKSNHHgALLQAGATPVYLETA-RNPYGFIGGIDAHCFEESYLRE 267 Escherichia coli K-12
5FKZ_E 210 AEQSYIVTNGTSTSNKIVGMYAAPSGSTLLIDRNCHKSLAH-LLMMNDVVPVWLKPT-RNALGILGGIPRREFTRDSIEE 287 Escherichia coli K-12
3Q16_C 210 ADRSYMVTNGTSTANKIVGMYSAPAGSTILIDRNCHKSLTH-LMMMSDVTPIYFRPT-RNAYGILGGIPQSEFQHATIAK 287 Escherichia coli K-12
2VYC_D 298 KISESPLTKDkagqkPSYCVVTNCTYDGVCYNAKEAQDLLEKTSDRLHFDEAWYGYARFN-PIYADHYAMRGEpgDHNGP 376 Escherichia coli BL21...
P44317 267 LIKEVAPEKLnqkrpFRLAVIQLGTYDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFI-PMMKDCSPLLLEl-NENDP 344 Haemophilus influenza...
P21169 260 QIRDVAPEKAdlprpYRLAIIQLGTYDGTVYNARQVIDTVGHLCDYILFDSAWVGYEQFI-PMMADSSPLLLEl-NENDP 337 Escherichia coli K-12
P37536 150 ALEAYPDAKG--------LVLTNPTYYGHSADLTEIITEAHHYGIPVLVDEAHGAHFILGePFPVSALKMGAD------- 214 Bacillus subtilis sub...
P21885 154 ALTEHPDAKG--------LLVINPTYFGVAADLKSIVELAHSFDVPVLVDEAHGVHIHFHdELPLSAMQAGAD------- 218 Bacillus subtilis sub...
P24169 268 LIAEVAPQRAkearpFRLAVIQLGTYDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFI-PMMADCSPLLLDl-NENDP 345 Escherichia coli K-12
5FKZ_E 288 KVAATTQAQW-----PVHAVITNSTYDGLLYNTDWIKQTLDVPS--IHFDSAWVPYTHFH-PIYQGKSGMSGE--RVAGK 357 Escherichia coli K-12
3Q16_C 288 RVKETPNATW-----PVHAVITNSTYDGLLYNTDFIKKTLDVKS--IHFDSAWVPYTNFS-PIYEGKCGMSGG--RVEGK 357 Escherichia coli K-12
2VYC_D 377 TVFATHSTHKLLNALSQASYIHVREGRGa-----INFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVI 451 Escherichia coli BL21...
P44317 345 GILVTQSVHKQQAGFSQTSQIHKKDKHIkgqdryVNHKRFNNAFMLHASTSPFYPLFATLDVNAKIQGSEAGRRLWHECV 424 Haemophilus influenza...
P21169 338 GIFVTQSVHKQQAGFSQTSQIHKKDNHIrgqarfCPHKRLNNAFMLHASTSPFYPLFAALDVNAKIHEGESGRRLWAECV 417 Escherichia coli K-12
P37536 215 --IVVQSAHKTLPAMTMGSYLHLNSSCR------INRDRVAEYLNRLQSSSPSYPIMASLDIARAYVQHIIEEQKLSDIL 286 Bacillus subtilis sub...
P21885 219 --IAATSVHKLGGSLTQSSILNMREGL-------VSKDRVQSILSMLTTTSTSYLLLASLDVARKRL-ATEGRQLAEETL 288 Bacillus subtilis sub...
P24169 346 GILVTQSVHKQQAGFSQTSQIHKKDSHIkgqqryVPHKRMNNAFMMHASTSPFYPLFAALNINAKMHEGVSGRNMWMDCV 425 Escherichia coli K-12
5FKZ_E 358 VIFETQSTHKMLAALSQASLIHIKGE--------YDEEAFNEAFMMHTTTSPSYPIVASVETAAAMLRGNPGKRLINRSV 429 Escherichia coli K-12
3Q16_C 358 VIYETQSTHXLLAAFSQASMIHVKGD--------VNEETFNEAYMMHTTTSPHYGIVASTETAAAMMKGNAGKRLINGSI 429 Escherichia coli K-12
2VYC_D 452 DEAVDFRQAMarlykeftADGSWFFKPWNKEVVTDPQtgktydfadaptkllttvqdCWVMHPGESWHGFKDIPDNWSML 531 Escherichia coli BL21...
P44317 425 KVGIEARKLV--------LNHCELIRPFIPTTIKGKKwqdydte------eiatnleFFKFHPTDTWHKFEGYADEQYFV 490 Haemophilus influenza...
P21169 418 EIGIEARKAI--------LARCKLFRPFIPPVVDGKLwqdypts------vlasdrrFFSFEPGAKWHGFEGYAADQYFV 483 Escherichia coli K-12
P37536 287 QRIETLKQTFd------sLTNAEAVNPANPLIIT---------------------------------------------- 314 Bacillus subtilis sub...
P21885 289 KLANQTRDR---------LNQIEGIYCVGSEILGSKA---------------------------------------AYSY 320 Bacillus subtilis sub...
P24169 426 VNGINARKLI--------LDNCQHIRPFVPELVDGKPwqsyeta------qiavdlrFFQFVPGEHWHSFEGYAENQYFV 491 Escherichia coli K-12
5FKZ_E 430 ERALHFRKEVqrl---reESDGWFFDIWQPPQVDEAE--------------------CWPVAPGEQWHGFNDADADHMFL 486 Escherichia coli K-12
3Q16_C 430 ERAIKFRKEIkrl---rtESDGWFFDVWQPDHIDTTE--------------------CWPLRSDSTWHGFKNIDNEHMYL 486 Escherichia coli K-12
2VYC_D 532 DPIKVSILAPGMG-EDGELEETGVPAALVTAWLGRH-GIVPTRTTDFQIMFLFSMGVTRGK 590 Escherichia coli BL21(DE3)
P44317 491 DPCKFLLTTPGISlETGEYEEFGVPATILANYLREN-GIIPEKCDLNSILFLLTPAETITK 550 Haemophilus influenzae Rd KW20
P21169 484 DPCKLLLTTPGIDaETGEYSDFGVPATILAHYLREN-GIVPEKCDLNSILFLLTPAESHEK 543 Escherichia coli K-12
P37536 315 DPLKLTIR-----------SKRGHSGYTLQSILERA-NIFTELADENQVLLVLPLGGKRRI 363 Bacillus subtilis subsp. subtilis str. 168
P21885 321 DPTKLIISV----------KSLGLTGHDVEKWLRESfNIEVELSDLYNILCIFTPGDSQND 371 Bacillus subtilis subsp. subtilis str. 168
P24169 492 DPCKLLLTTPGIDaRNGEYEAFGVPATILANFLREN-GVVPEKCDLNSILFLLTPAEDMAK 551 Escherichia coli K-12
5FKZ_E 487 DPVKVTILTPGMD-EQGNMSEEGIPAALVAKFLDER-GIVVEKTGPYNLLFLFSIGIDKTK 545 Escherichia coli K-12
3Q16_C 487 DPIKVTLLTPGME-KDGTMSDFGIPASIVAKYLDEH-GIVVEKTGPYNLLFLFSIGIDKTK 545 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap