Conserved Protein Domain Family
KRAB

?
pfam01352: KRAB 
KRAB box
The KRAB domain (or Kruppel-associated box) is present in about a third of zinc finger proteins containing C2H2 fingers. The KRAB domain is found to be involved in protein-protein interactions. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B. The A box plays an important role in repression by binding to corepressors, while the B box is thought to enhance this repression brought about by the A box. KRAB-containing proteins are thought to have critical functions in cell proliferation and differentiation, apoptosis and neoplastic transformation.
Statistics
?
PSSM-Id: 396083
View PSSM: pfam01352
Aligned: 524 rows
Threshold Bit Score: 45.0855
Threshold Setting Gi: 52545948
Created: 22-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_028910718 243 LVTFKDVTMSISQEEWEQLDPDQVDFYGEyVPQENCDFVVSLG 285 platypus
PNI81103      64 TVAYEDLSVDYTQKKWKGLTLSQRALQWN-MMPENHHSMASLD 105 chimpanzee
CAH56173       5 FVTLKDVGMDFTLGDWEQLGLEQGDTFWD-TALDNCQDLFLLD 46  human
XP_028020659  32 VTFEDVAVYFSREEWGLLNLTQRSLYRDV-MLENFALIGSLGS 73  Balaenoptera acutorostrata scammoni
Q8BGS3       224 MVKIEDMAVSLILEEWGCQNLARRNLNRD-SRQMNLGNVFSQG 265 house mouse
XP_001373597 212 LVKIEDMAVSLIQEEWGLLDPAQKDLCND-GRPENYGHVYSLG 253 gray short-tailed opossum
Q8NHY6       231 LVTIKNLAVDFRQQ----LHPAQKNFCKN-GIWENNSDLGSAG 268 human
XP_004776997 235 LVAIANVAVDFSQQ----LDPARKSICKN-MRWESHGDLGSVG 272 domestic ferret
XP_017195977  47 VTFSDVAVDFSPEEWGWLSSAQRDLYREV-TVQNYENLVSLGL 88  rabbit
XP_007499150 229 PVTCEDVTVPLSQEEWRCLNSAQRVLYKG-IAQEKFRNVDSVG 270 gray short-tailed opossum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap