5NIJ,4N6N


Conserved Protein Domain Family
Peptidase_C13

?
pfam01650: Peptidase_C13 
Click on image for an interactive view with Cn3D
Peptidase C13 family
Members of this family are asparaginyl peptidases. The blood fluke parasite Schistosoma mansoni has at least five Clan CA cysteine peptidases in its digestive tract including cathepsins B (2 isoforms), C, F and L. All have been recombinantly expressed as active enzymes, albeit in various stages of activation. In addition, a Clan CD peptidase, termed asparaginyl endopeptidase or 'legumain' has been identified. This has formerly been characterized as a 'haemoglobinase', but this term is probably incorrect. Two cDNAs have been described for Schistosoma mansoni legumain; one encodes an active enzyme whereas the active site cysteine residue encoded by the second cDNA is substituted by an asparagine residue. Both forms have been recombinantly expressed.
Statistics
?
PSSM-Id: 396290
View PSSM: pfam01650
Aligned: 34 rows
Threshold Bit Score: 170.932
Threshold Setting Gi: 81794387
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5NIJ_C    19 RWAVLVAGSSGYWNYRHQADICHAYQLLRK-GGLKEENIVVFMYDD-IANNYENPRPGTIINSPHGKDVYQG-VPKDYTG 95  thale cress
Q08BI0    27 AWVLLVAGSKDWDNYRHQANVCCAYQLMKK-QGIPDEQIVVMIYDD-IANNPNNPFPGSIRSVVDQTNVYKS-VPLDYTG 103 zebrafish
OZN69306 341 LYALSLGGDGRQGVFLREAD--YAGDLLGQrFAARGV-IRLVNHRDhFGDR---PLAT-------RESLSRA-------V 400 Pseudomonas aeruginosa
Q8P9N6   124 LYVVGFAGDASDDVFRNETL--YLKQLFEQrFDARGRVITLVNHPDnLGERPYAPLAT-------YDNLYDT-------L 187 Xanthomonas campest...
Q4K5F2   335 LYSLTLAGDGKQSVFLREAD--YVSNMLASrFGAYGQ-IRLVNHRDhLMNR---PMAT-------RENLRRA-------A 394 Pseudomonas protege...
Q88QE3   400 LYSLVVAGDGQQSVFLREAD--YVSRMLKVrFGARGQ-VTLVNHRDhMATR---PMAT-------RENLSRA-------A 459 Pseudomonas putida ...
EAX90337  13 TWAVIFCGSRDFYNYRHTADSYYMYHLIAEvNNLDKDKIILMCYDD-IVNDAENPFKGQIFRSLDHLNVYPGrANVKYTA 91  Trichomonas vaginal...
Q6EHZ7    12 RFAVLIAGSNDFYNYRHQADIFNMYQQLVK-RGFDDQHITMMAYDD-IALSSENPFRGKVFHTLKHVNIYPGsSKINYAH 89  Trichomonas vaginalis
P09841    37 KWAVLVAGSNGYPNYRHQADVCHAYHVLRS-KGIKPEHIITMMYDD-IAYNLMNPFPGKLFNDYNHKDWYEG-VVIDYRG 113 Schistosoma mansoni
P42665    31 KWAVLVAGSNGFENYRHQADVCHAYHVLLS-KGVKPEHIITFMYDD-IAHNKENPFPGKIFNDYRHKDYYKG-VVIDYKG 107 Schistosoma japonicum
5NIJ_C    96 DDVNVDNLFAVILGDKTavkgGSGKVVDSGPNDHIFIFYSXHGGPG---VLGMP--T-SPYLYANDLNDVLKKKHALGTY 169 thale cress
Q08BI0   104 NKVKSKNFLAVLRGDDS----AGGKIIRSKKNDNILIYMSGVGSDA---NFKFP----QDSLDAHQFTTTINTMSDDKKY 172 zebrafish
OZN69306 401 RTLAER----------------------SGPEDLVFIYLTSHGSSDhqlALDMPglN-LGDLPAAELAELLAPLRQRDK- 456 Pseudomonas aeruginosa
Q8P9N6   188 AAIGKR---------------------MDRKEDALLLFVTTHGTEDhtlYVQVDqnE-EDFISPQDLRKALDDAGIGNR- 244 Xanthomonas campest...
Q4K5F2   395 QTLAER----------------------SGPEDLVFIYLTSHGTSAhelVLDQPrlE-LADLPADELATALAPLKNRDK- 450 Pseudomonas protege...
Q88QE3   460 ATLAER----------------------SGPEDLVFIYLTSHGSQDhqlVLDQPrlQ-LADLAADELATALAPLKDRDK- 515 Pseudomonas putida ...
EAX90337  92 GKVTATNFYKVLTGDN-----SQGPALQSTANDNVMIFFDNHGGDG---ILGVPdgC-GDYIYANDLKQALQTMHDKGMY 162 Trichomonas vaginal...
Q6EHZ7    90 NSVTADQFYTVLT------------TLKSTTSDNVYIYYDNHGGPG---ILGVPdgVpGGYIEAEPLAKAFDTMEAKGLY 154 Trichomonas vaginalis
P09841   114 KNVNSKTFLKVLKGDKS----AGGKVLKSGKNDDVFIYFTDHGAPG---LIAFP----DDELYAKEFMSTLKYLHSHKRY 182 Schistosoma mansoni
P42665   108 KKVNPKTFLQVLKGDKR----AGGKVLKSGKNDDVFIYFTDHGAPG---ILAFP----DDDLHAKPFINTLKYLRQHRRY 176 Schistosoma japonicum
5NIJ_C   170 KSLVFYLEAXESGSIFEGlLPEGLNIYATTASNAEESSWGTYCpgeepsPPPEYETCLGDLYSVAWMEDSGMHNLQTETL 249 thale cress
Q08BI0   173 SKMVIFMDSDNSQSVFKG-LFTNIHVYGVASCDSANQNRSVQN-------DPDRGIYLSDQFSAAWLTFISTADLEKATF 244 zebrafish
OZN69306 457 ---VLVVSACYSGGFIPP--LKDERTLILTAARADRVSFGC--------SDDADFTYFGRALLANALNRTDD-------L 516 Pseudomonas aeruginosa
Q8P9N6   245 ---VIVLSACYSGGFIPA--LRSATTLVLTAARADRPSFGC--------GNTSNATYFGQAWLIDAMNQVAD-------P 304 Xanthomonas campest...
Q4K5F2   451 ---IIVISSCYSGGFIPA--LKDERTLIMTASQADRVSFGC--------SEEADFTYFGDALFAQALNQTDD-------L 510 Pseudomonas protege...
Q88QE3   516 ---VIVISACYSGGYIAP--LKDERTLIMTAARADRVSFGC--------SEEADFTYFGDALFAEALNQTDD-------L 575 Pseudomonas putida ...
EAX90337 163 KNCFFPITACYAGSVAKV-VAGVPKLYMMTAANDHESSYADIW-------DDSLGEYLTSEFSAVSQLYWQAHPT--CTI 232 Trichomonas vaginal...
Q6EHZ7   155 GKLFFGIEACYSGSVAAV--FRAKNMCTITAANDDESSYAAVY-------DSTVGVYLSNEFSNYFMAYLDSNPQ--NTI 223 Trichomonas vaginalis
P09841   183 SKLVIYIEANESGSMFQQiLPSNLSIYATTAANSTECSYSTFC------GDPTITTCLADLYSYNWIVDSQTHHLTQRTL 256 Schistosoma mansoni
P42665   177 SKLVIYVEACESGSMFAGlLPTDINIYATTAARPDESSYATFC------DDPRISSCLADLYSYDWIVDSEKHQLTQRTL 250 Schistosoma japonicum
5NIJ_C   250 HQQYELVKRRTapvgysYGSHVMQYGDVGISKDNLDL-Y----------------------------------------- 287 thale cress
Q08BI0   245 SKLFEYIKNK-------DDSCPCEIGDKEIPKLLISN-F----------------------------------------- 275 zebrafish
OZN69306 517 SKAFELAKEEV------RQREKEEGFEASEPQAWLPErVlahwrtlrgqqaer-------------------------al 565 Pseudomonas aeruginosa
Q8P9N6   305 VAAFDAAKVAI------TAREKEDGELPSLPQQSVGKdIgavlarwragfqpgpalaypyppviaeaaddavadqgdtpa 378 Xanthomonas campest...
Q4K5F2   511 EHAFKLARGIV------AEREQADGFEASEPQIWAPRgViahwqqlrkqqa----------------------------r 556 Pseudomonas protege...
Q88QE3   576 KQAFELARASV------AEREQREGFEASEPQLWAPPaVlehwhqlrqqqaeea-----------------------lrn 626 Pseudomonas putida ...
EAX90337 233 GDSFEPIKNGV------KQSHVMEYGDTSLKTLPVSL-F----------------------------------------- 264 Trichomonas vaginal...
Q6EHZ7   224 GNLYTKVKAQT------TGSHVCYYGDVNMKNLKLSD-F----------------------------------------- 255 Trichomonas vaginalis
P09841   257 DQQYKEVKRET------DLSHVQRYGDTRMGKLYVSE-F----------------------------------------- 288 Schistosoma mansoni
P42665   251 DQQYKEVKFET------NLSHVQRYGDKKMGKLYLSE-F----------------------------------------- 282 Schistosoma japonicum
5NIJ_C   288 -----------MGT 290 thale cress
Q08BI0   276 -----------LKL 278 zebrafish
OZN69306 566 asregktgegaAGK 579 Pseudomonas aeruginosa
Q8P9N6   379 dtkdaapskpaQPT 392 Xanthomonas campestris pv. campestris
Q4K5F2   557 kalqsvsisskEAQ 570 Pseudomonas protegens Pf-5
Q88QE3   627 atqanvskqakMPG 640 Pseudomonas putida KT2440
EAX90337 265 -----------LGT 267 Trichomonas vaginalis G3
Q6EHZ7   256 -----------LGT 258 Trichomonas vaginalis
P09841   289 -----------QGS 291 Schistosoma mansoni
P42665   283 -----------QGS 285 Schistosoma japonicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap