4JBK,3RN2,5YZW


Conserved Protein Domain Family
HIN

?
pfam02760: HIN 
Click on image for an interactive view with Cn3D
HIN-200/IF120x domain
This domain has no known function. It is found in one or two copies per protein, and is found associated with the PAAD/DAPIN domain pfam02758.
Statistics
?
PSSM-Id: 397056
Aligned: 43 rows
Threshold Bit Score: 192.035
Threshold Setting Gi: 942191164
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4JBK_D        15 EKPMTVMVLTATEPFNY---KEgKEnMFHATVATESQYYRVKVFNMDLKEKFTENKFITISKYFN-SSGILEINETATVS 90  house mouse
3RN2_B        12 KRCLPVMVLKAKKPFTFetqEG-KQeMFHATVATEKEFFFVKVFNTLLKDKFIPKRIIIIARYYR-HSGFLEVNSASRVL 89  human
XP_005339478 158 KDRLIVLVLKAMKPFQFetqDGrKQeMFHATVATEKEFFLVKVFNMQLKDKFAPKRTIIISKYCW-HSGVLEVNSASLIV 236 thirteen-lined ...
ELV10607     125 KGGLIVMVLKAMNPFEFktqEG-KQeMFHATVATEKEFFLVKVFNTQLKDNFTPKRTIIISNYYYrHNGILEVNSASRVF 203 Chinese tree shrew
XP_003795264 151 KGRLTVLVLKATEPFEFetqEGnREmMFHATVATETEFFFVKVFKTQLKDKFTPKRIIVMSKYYW-HSGFLEVNSASLVS 229 small-eared galago
XP_001057147 157 QDSLVVMVLKAMNPFECetqEG-KQkIFHATVATETEFFFVKVLNAQFKDKFIPKRTIQISNYLR-HSYFVEVTSSSVVV 234 Norway rat
XP_016285767 203 TMPVVMKVLKVKEIFEYetkEKtKT-MFHATVANEHEFIRVKVLNIDVKEYFNQKNVIEISEGFW-KSGFLEVNKSSKVI 280 gray short-tail...
XP_012403472 188 TMPMVVMVLKVKETFEYdtqKGkKE-MFHAIVANEHEFIRVKVLNMNVKEQFKKNKVIEISKAYW-NRGFLEINKCSRVE 265 Tasmanian devil
XP_006005227 323 QS-LKVKVIKSFKNFKCkyrNTdKS-IFYAILADDSDFIIAKVIDRKGKKDFSKGASIIFTNFKY-WNGILEMTEYTKLE 399 coelacanth
XP_008522925 155 KGSMTVMVLKATKPFEFetkEGkQE-MFHATVATESEFFFVKVFNKKLKDKFTPKNIIIISKYYW-HSHFLEVNSVSRVS 232 Przewalski's horse
4JBK_D        91 EAAPNQMFEVPKNIIRSAKETLKISKIKELDSG---TLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYE 167 house mouse
3RN2_B        90 DAESDQKVNVPLNIIRKAGETPKINTLQTQPLG---TIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCK 166 human
XP_005339478 237 DAKSDQEINVPPYIIRKAGETPKINKLQTQPLG---TIVNGLFVIQKKTEKRDHVLFDVSDNTGSMEVLVFKKQNQVDCE 313 thirteen-lined ...
ELV10607     204 DAKPNQEVTVPKSIIRKAGQTLKINKLQTQPLG---TIVNGIYVVQKKTEQKNSVLFDLSDNTGRMEVLVPGKQNKIECE 280 Chinese tree shrew
XP_003795264 230 DAKSNQTICVPRNICRKAGETPKIKKLQSQPIG---TIVNGLFVVQKKTEKDNSVLFNINDNTGSMKVSVLGKQKDTNFE 306 small-eared galago
XP_001057147 235 DVESSHKVCVPNNIMKKAGETPKISKLKTLPCG---TIVNGLFKVQKITEQKDRVIYGIHDKRGTMEVLVLGNQSKTKCE 311 Norway rat
XP_016285767 281 DLGANREMEVPQNIIRKASQTPKIQSLLKLKNKkerIYVDGVYEINKKTETDKCTIFVVKDNTGTIKVVTFGKWAKIKCD 360 gray short-tail...
XP_012403472 266 DMTTNKEIIVPKNIIRKAAKTTKLQMLKTLKPG---SYVDGVYEIHKKTEKENCTFFEVKDNTGNIKVVVFGKWAKIKSE 342 Tasmanian devil
XP_006005227 400 KL-TGPPVEVPMKIREKAKKGILLEEVKKLPLE---TIVSGLFNVNKWRKVKNGYILTAEDETGKMDIAIFNQVDQIILK 475 coelacanth
XP_008522925 233 DAKSDQQISVPKHIIRKAGETPKINKLQTQPHG---TIVNGVFVIQKKTERRNHQLFDLSDSTGRMEVLVLGKQNKIECE 309 Przewalski's horse
4JBK_D       168 KGDKLQLFSFHL 179 house mouse
3RN2_B       167 EGDKVRLTFFTL 178 human
XP_005339478 314 EGDKLRLTFFEL 325 thirteen-lined ground squirrel
ELV10607     281 EGDKLRLTFLEL 292 Chinese tree shrew
XP_003795264 307 EGDKLQLTFFEL 318 small-eared galago
XP_001057147 312 EGDKIRLTFFEV 323 Norway rat
XP_016285767 361 ERDKLRLTCFEL 372 gray short-tailed opossum
XP_012403472 343 KGDKLRLTCFEy 354 Tasmanian devil
XP_006005227 476 DNKKMHFLGFKv 487 coelacanth
XP_008522925 310 EGDKLRLTFFEL 321 Przewalski's horse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap