Conserved Protein Domain Family
MPC

?
pfam03650: MPC 
Uncharacterized protein family (UPF0041)
Statistics
?
PSSM-Id: 397629
View PSSM: pfam03650
Aligned: 42 rows
Threshold Bit Score: 148.147
Threshold Setting Gi: 549051353
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q21828        11 YFKQHSTAEWKHYflSTHFWGPVANWGLPLAALGDLKKNPDMISGPMTSALLIYSSVFMRFAWHVQPRNLLLFACHFANF 90  Caenorhabditis ...
XP_020160513   5 KLQAFWNHPAGPK--TIHFWAPTFKWGISIANVADFAKPHEKISYPQQVVIACTGIIWSRYSMVITPRNWNLFSVSVAMS 82  Aegilops tausch...
XP_001527245   1 mstqSTFKKAFKYmcTTHFWGPVSNFGIPVAAIMDLKKDPDLISGPMTGSLILYSLVFMRYSMAVTPKNYLLFGCHLVNE 80  Lodderomyces el...
EKG14781       8 inakiRSNKALDYfcSTHFWGPASNFGIPLAAVMDTQKDPEIISGGMTAALIGYSSVFMRYALAVTPKNYLLFGCHAVNW 87  Macrophomina ph...
XP_004177513  13 liSKYINKQTLKYvfTTHFWGPISNFGIPIAAVYDLQKDPNRISGPMTGALIAYSAVFMKYALAVQPKNFLLFACHFINE 92  Tetrapisispora ...
P53157        13 FLQKYINKETLKYifTTHFWGPVSNFGIPIAAIYDLKKDPTLISGPMTFALVTYSGVFMKYALSVSPKNYLLFGCHLINE 92  Saccharomyces c...
Q6FS56        13 iIQKYINKETLKYvfTTHFWGPVSNFGIPIAALYDLKKDPTLISGPMTLALVAYSGVFMKYALAVTPKNYLLFACHFINE 92  [Candida] glabrata
CCC69953      13 lIQKYINKETLKYvfTTHFWGPVSNFGIPIAALYDLKKDQTLISGPMTFALVAYSAVFMRYATAVTPKNYLLFGCHFVNE 92  Naumovozyma cas...
XP_003956348  13 vLQKYINKETLKYvfTTHFWGPVSNFGIPIAALYDLKKDPTLISGPMTFALIAYSGVFMKYALAVTPKNFLLFGCHFVNE 92  Kazachstania af...
CCE93514      13 vIQKYINKETLKYvfTTHFWGPVSNFGIPIAAIYDLKKDPTVISGPMTGALVIYSAVFMKYALAVTPTNYLLFGCHLVNE 92  Torulaspora del...
Q21828        91 SAQGAQLGRFVNHNYLHYVEDPVhhKLMMKKEVL 124 Caenorhabditis elegans
XP_020160513  83 GTGLYQLSRKMRKDYFSGAEKEAaaASLELev-- 114 Aegilops tauschii subsp. tauschii
XP_001527245  81 IAQLGQGYRWVSYHYLDEGK-----AKDKAEREA 109 Lodderomyces elongisporus NRRL YB-4239
EKG14781      88 SAQVVQGYRYVNHWHMGGREKS---LQEKAKEGL 118 Macrophomina phaseolina MS6
XP_004177513  93 TAQLGQGFRFLNYHYFIDDA-----KRAKIDEKF 121 Tetrapisispora blattae CBS 6284
P53157        93 TAQLAQGYRFLKYTYFTTDE-----EKKALDKEW 121 Saccharomyces cerevisiae S288C
Q6FS56        93 SAQLGQGYRFIDFNYFKSDE-----EKNKIIEEY 121 [Candida] glabrata
CCC69953      93 VAQLAQGYRFIDFNYIMSED-----QRQEIHRKH 121 Naumovozyma castellii CBS 4309
XP_003956348  93 AAQLSQAYRFIDFS-LKSDE-----QKAAIQSKY 120 Kazachstania africana CBS 2517
CCE93514      93 AAQLGQGYRFLHYNYLADED-----EKKAIDEKW 121 Torulaspora delbrueckii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap