Conserved Protein Domain Family
Mtc

?
pfam03820: Mtc 
Tricarboxylate carrier
Statistics
?
PSSM-Id: 397754
Aligned: 141 rows
Threshold Bit Score: 297.873
Threshold Setting Gi: 597501025
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KOS19211       10 ELPASQYDLGTYSGRVRHALSITDPSTLLAGSKGLEHAKQLVTDYKTGK-IEHMTP-ELWHAKKIVDSTLHPDTGEPVFL 87  Escovopsis weberi
KOF81390       46 QLNCSRFNQETFTGRLLHFLDVIDPRTLLVSDKKLQSSIQLLELYKNGQlPDNVPNrQLWEAQKVKQAIIHPDTGEKIFM 125 Octopus bimacu...
XP_009018099   10 RLDASRFDQSNFKGRLLHFLNVTDPRTLFVSKKRLQESIDLLELYKGGKlPKGTTDkDLWEAQKIKQAIIHPDTNQIIPM 89  Helobdella rob...
XP_013405908   19 RLNESRFDQNTFSGRLRHFLDVVDPKTLFTSNQRLKESCQLLQDFQNGKlPPSISNkELWEAQKIKQAIIHPDTGEKIFM 98  Lingula anatina
17_pfamImport   1 TLDSSKYDQGTFSGRFKHFLNVIDPRTLLTTKNELEDSLSLLNSYENGSlPQNVTDaRLWNAQKIKQAIIHPDTGDKIPM 80 
XP_011414570    9 RLGKSRYDQSTFDGRLRHFFDVIDPRTLFTSEEKLKSCVKLLDDFSKGHlPPTVTNkDLWEAQKIKQAIIHPDTGEKIFM 88  Pacific oyster
ESO85043       12 RLNKPRFDQSTFSGRLRHFLDIIDPSTLLTSEKKLKESCQLLNDYKKGQlPPGTRDeDLWKAQKIKQAIIHPDTGEKILM 91  owl limpet
XP_001635168   19 SLVQPRFDQGTYIGRLYRCFDITDPRTLFTSESKLQSSIKLLEDFKKQQlVPGTTDkQLWEARKIKEAIIHPDTNSKVLM 98  starlet sea an...
VDN53889       17 RLNEPRFPQDTFLGRYFHFLDIIDPRTLFISNEELNSSIKLLNDYKEGKgSAKISDkELWKAQKIKNAIVHPDTNKKIFP 96  Guinea worm
XP_022779480   14 SLSEPRFDQKTYLGRLKRCLDVTDPRTLFVSEKKLQDSIQLLKQFENGTlPQGTVDkKLWEARKIKEAIIHPDTGQKVFM 93  Stylophora pis...
KOS19211       88 PFRMSCFVLSNLIVTAGMLQPGLGTAGTIAWQVANQSLNVAINSSNANKSSPMTAATLAKSYAVAVTASCSVALGLNALV 167 Escovopsis weberi
KOF81390      126 PFRMSGFVPFGSPFVIGMLLPNPTIGKTILWQWMNQSHNACVNYANRNATKPTPMKRFIVGYVGAVSTAVSIAVGISVLI 205 Octopus bimacu...
XP_009018099   90 PFRMSGFVPFGSPIVVGLLLPNPTLKQTVFWQWLNQSHNACVNYSNRNATKQSTVSKFIIGYVGAVTSAVSIAVGLSLMI 169 Helobdella rob...
XP_013405908   99 PFRMSGFVPFGSPIVVGLLLPNPTIKATIFWQWLNQSHNACVNYSNRNATKPTPISRFLLGYGAAVGSAVTIAVSLGVMI 178 Lingula anatina
17_pfamImport  81 PFRMSGYVPFGTPIVIGLLLPNQTLVSTVFWQWLNQSHNACVNYCNRNATQNTSMSDFISGYVGAVSSAVGIALGLNALV 160
XP_011414570   89 PFRMSGFVPFGSPMVVGLLLPNQTIASTIFWQWINQSHNACVNYANRNATSPTPMSRFLLGYTGAVSTAVSIAVGLNLLI 168 Pacific oyster
ESO85043       92 PFRMSGYVPFGSPMVVGLLLPNPSITSVIFWQWLNQSHNACVNYSNRNASKPTPINRFIMGYLGAVTSAVGIALGLKNLI 171 owl limpet
XP_001635168   99 PFRMSGYVPFGTITVVGMLLPAPGLKTVIFWQWLNQSHNAAVNFSTEMQQGKTPTSRFLLSYLGAITSAVTIAVGLSMVV 178 starlet sea an...
VDN53889       97 AFRMSGYVPFGWITVTGMLLPNPSWSTILFWQWMNQSHNALVNYSNRNAT--QDQSKFIKAYCIAVSSACSTATGLTYLI 174 Guinea worm
XP_022779480   94 PFRMSGYVPFGTITVVGMLLPAPSLKTVIFWQWMNQSHNAAVNYSNRNASKPTPTSRFLLSYFGAVTSAVTIALGLTTLV 173 Stylophora pis...
KOS19211      168 PRl-R-VAPatraVLSRLvpfaAVASAGALNVYLMRRGEIAAGIDVRpvfpsarekemekqgdkDQEGesASLGRSRTAA 245 Escovopsis weberi
KOF81390      206 EKaeR-FSPatkiFIKRFvpfpAVATASTCNVVLMRNSEIPQGIEVF-----------------DSNN--KPLGASVVAA 265 Octopus bimacu...
XP_009018099  170 KKt-SgLTPsmklIVQKFvpfpAVATASTCNVVLMRNNELHDGIEVF-----------------DSQN--KVIGTSKVAA 229 Helobdella rob...
XP_013405908  179 KRa-NaLTPsmklLIQRFvpfpAVATASVCNVICMRNNELSEGIEVM-----------------DKEG--RIVGTSQIAA 238 Lingula anatina
17_pfamImport 161 KRstK-LSPltrsLVQRFvpfpAVATASVCNVVLMRHSELSTGIEVT-----------------DAND--NVVGISKKAA 220
XP_011414570  169 QKanK-FSPatkvLIQRFvpfpAVACASTCNLLLMRNSELSTGIEVE-----------------DHNG--NVIGKSKVAA 228 Pacific oyster
ESO85043      172 KKanR-FSPatklLIQRFvpfpAVASASVCNVVLMRNNELSEGIDVT-----------------DKDG--KVVGTSLIAA 231 owl limpet
XP_001635168  179 QKa-KfSTPvmrgLMQRLvafpATAAANICNVVLMRNHELFTGIEVK-----------------DKEG--NIVGTSKIAA 238 starlet sea an...
VDN53889      175 KKc-KnISInkqiFLQRFvalpATSLASSLNILSMRWSEIFSGIEIY-----------------DSEK--NVIGISKVAA 234 Guinea worm
XP_022779480  174 KRa-KiSNPsmkaLLQRLvaypATATANICNVVLMRNHELFTGIEVK-----------------DKDG--NVVGTSKLAA 233 Stylophora pis...
KOS19211      246 KIAVGETAASRVINSTPIMILPALALYHIQfRQAWYraLLeRAWVRaRPrvaaaipigINLGLITAVSFGALPLALAVFP 325 Escovopsis weberi
KOF81390      266 KVALFQTALTRMFLPAPILIIPPLIMSLLE-KTKLL--RT-YPKLH-LP---------FNATVCTLTFGCALPVAIALFP 331 Octopus bimacu...
XP_009018099  230 RQALIDTAITRMFLPAPLLLIPALVMTFAE-KTQLL--IR-RPRLH-LP---------INASVTTLSFALALPIAIALFP 295 Helobdella rob...
XP_013405908  239 KKALLETAMTRAVLPAPILIIPPVVMTQLE-KTKFL--QT-RPRFH-LP---------IHAAVVTACFGFALPVAIALFP 304 Lingula anatina
17_pfamImport 221 KKALVETAMTRAFLPAPILLIPPVIMTMLE-RTKWF--PR-YPRLN-LP---------AQAVLVTASFGLALPLAIALFP 286
XP_011414570  229 KKALMETAITRMFLPAPILVIPPIIMSLLE-KTAFF--KR-YPRVH-LP---------VHAAVVTVCFGLALPVAIAIFP 294 Pacific oyster
ESO85043      232 KKALIETAITRLVLPAPILILPPIIMSYIE-RTKFL--KR-YPKIH-LP---------VNAFVCTAAFALALPVAIALFP 297 owl limpet
XP_001635168  239 KNAIFETTLTRIILPAPLLVGPALIMAPLE-RTNFL--KA-RPRLH-LP---------VQAAVCVAVFGLALPLAIAMFP 304 starlet sea an...
VDN53889      235 KKAVFETTLTRAFLPVPLLILPPCIMPFFE-RMEFV--KK--CWRRhLV---------INAIVCTLSFAFSLPISLALFP 300 Guinea worm
XP_022779480  234 RKAVFETTITRILLPLPVLVIPPFVMQLLE-RTKFM--LS-RPKLH-LP---------VQALVCVAAFGFGLPLAIALFP 299 Stylophora pis...
KOS19211      326 QKQEISPERLEPEFHGKGGsTGKVWFNRGL 355 Escovopsis weberi
KOF81390      332 QTCKIRVEKMEPEIRGLTT-EEYVYCNKGL 360 Octopus bimaculoides
XP_009018099  296 QISSISKSQLEDEIQNSSN-EEILFYNKGL 324 Helobdella robusta
XP_013405908  305 QFSQISTKDLEAKLQEATS-EPAVYYNKGL 333 Lingula anatina
17_pfamImport 287 QKSQISVEELEPEIKIKtke-vaLYYNKGL 315
XP_011414570  295 QYSKVDTASLEPEIQKLTK-DTTLIYNKGL 323 Pacific oyster
ESO85043      298 QYSQISTKNLEKEFLNLTN-EDVLYYNKGL 326 owl limpet
XP_001635168  305 QVSEVFTKDLEPEIQASTK-EAKLFYNKGL 333 starlet sea anemone
VDN53889      301 QQSKIETIKLETELQKLTN-EPILYYNRGL 329 Guinea worm
XP_022779480  300 QTSEVLPSKLESEIQQKt-kETKLYYNKGL 328 Stylophora pistillata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap