3BWO


Conserved Protein Domain Family
Alliinase_C

?
pfam04864: Alliinase_C 
Click on image for an interactive view with Cn3D
Allinase
Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species. Allicin is synthesized from sulfoxide cysteine derivatives by alliinase (EC:4.4.1.4), whose C-S lyase activity cleaves C(beta)-S(gamma) bonds. It is thought that this enzyme forms part of a primitive plant defense system.
Statistics
?
PSSM-Id: 398502
Aligned: 10 rows
Threshold Bit Score: 598.989
Threshold Setting Gi: 75156708
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BWO_D  25 VNLDHGDPTAYEEYWRKMGDRCTVTIRGCDLMSYFSdMTnLcWFLEPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLC 104 thale cress
Q942G4 111 ADGQGGDPLFLEPYWKRHAAASAVVFSGWHRLSYIT-TD-G-HLKSVELDRQIRRLHRAVGNAVVDDKYLVFGTGSTHLI 187 Japanese rice
Q76BK3 104 ADVVSGDSLFLEEYWMRHKSNTAVLISGWHRMSYYF--ApG-SFISVVLKRHIKLLHHAVGNAKTDGRYIVFGTGVTQLL 180 onion
Q9M7L9 102 ADATTGDAMFLEKYWLHHRVNTAMLESGWHRMSYF---IgH-NFMSDELDRHIRLLHNAVGNAKVDDKFLVFGNGVTQLL 177 onion
Q43366  93 ADVASGDGLFLEEYWQQHKENSAVLVSGWHRMSYFF-NPvS-NFISFELEKTIKELHEIVGNAAAKDRYIVFGVGVTQLI 170 onion
Q93Z38  91 VDANSGDPLFLEPFWMRQAERSAILVSGWHRMSYIY--EdG-TYVSRELEKVIRKLHSVVGNAVTDNRFVIFGSGTTQLL 167 thale cress
Q9LR29  26 INLDQGDPTAFQEYWMKKKDRCTVVIPAWDLMSYFSdTKnVcWFLEPELEKAIKALHGAIGNAATEERYIVVGTGSSQLC 105 thale cress
O04927  87 ADVASGDALFLEEYWKDHKENTAVLVSGWHRMSYFFpEKdS-DFMSAELKRTITELHEIVGNAETKGKHIVFGVGVTQLL 165 Allium tuberosum
Q94A02  79 INLKFGDPTVYERYWQENGEVTTMVIPGWQSLSYFSdENnLcWFLEPELAKEIVRVHKVVGNAVTQDRFIVVGTGSTQLY 158 thale cress
Q8LL95  68 INLD-GDPTMYEAFWREAGERAAAVIPGWWGVSYFSnAGgLcWYLEPELEREVRRVHRLVGNAMADGYHLVVGTGTTQLF 146 Aegilops tauschii
3BWO_D 105 QAAVHALSSL----ARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGF-----DKK--GPYIELVTSPNNPDGTI 173 thale cress
Q942G4 188 NALVYALSPEg--nAASPPASVVATVPYFAMYKSQTVMFDGREYRWDGTTAAWannnsSRNptRGFIEFVTSPNNPDSTL 265 Japanese rice
Q76BK3 181 NGLIISLSPNvtsdPKAPVKKVVAAVPYYPVFRRQTSFFNFKGYEWKGNASDYv----KTTspENFIELVTSPNNPEGRL 256 onion
Q9M7L9 178 NGVIISLSPNvtatPTAPIKKVVAYVPYYPVFKSQTSFFNFKGYEWKGNASDYv----NTTnpQDFIELVTSPNNPDGLL 253 onion
Q43366 171 HGLVISLSPNmtatPCAPQSKVVAHAPYYPVFREQTKYFDKKGYEWKGNAADYv----NTStpEQFIEMVTSPNNPEGLL 246 onion
Q93Z38 168 AAAVHALSLTn--sSVSSPARLLTSIPYYAMYKDQAEFFDSAHLKFEGNASAWkq-sgRNDniTQVIEVVTSPNNPDGKL 244 thale cress
Q9LR29 106 QAALFALSSL----SEVKPVSIVAAVPYYSTYVEEASYLQSTLYKWEGDARTF-----DKK--GPYIELVTSPNNPDGIM 174 thale cress
O04927 166 HGLVLTISPNisncPTAGPAKVVARAPYYAVFRDQTSYFDNKGYEWKGNAANYv----NDPnpNQFIELVTSPNNPEGNL 241 Allium tuberosum
Q94A02 159 QAALYALSPH----DDSGPINVVSATPYYSTYPLITDCLKSGLYRWGGDAKTY-----KED--GPYIELVTSPNNPDGFL 227 thale cress
Q8LL95 147 QAAMYALAPT----STDRPVGVVSPAPYYS-----TDLLLSGYYRWAGDANAF-----HGDhgGENIELVVSPNNPDGAI 212 Aegilops tauschii
3BWO_D 174 RETVVnrpDDDEAkvIHDFAYYWPHYTPITRRQDHDIMLFTFSXITGHAGSRIGWALVKDKEVAKKMVEYIIVNSIGVSK 253 thale cress
Q942G4 266 HEPIL---AGSSA--IVDHAYYWPHLTHIPAPADEDVMLFTTSKLSGHAGSRFGWALVRDEKVASRAISYIEESTVGTSR 340 Japanese rice
Q76BK3 257 RHSII---KGSSA--IYDQVYYWPQYTAIKYASDENIMLFSMSKFTGHSGSRFGWAMIKEEKVYNKITEYMQQNSEGTSH 331 onion
Q9M7L9 254 RKSII---PGSLA--VYDHATYWPHYAPIKYASDEDIMLFALSKYTGHSGSRFGWAFVRDKSVYDKLTTYISTNSEGVSR 328 onion
Q43366 247 RHEVI---KGCKS--IYDMVYYWPHYTPIKYKADEDIMLFTMSKYTGHSGSRFGWALIKDETVYNKLLNYMTKNTEGTSR 321 onion
Q93Z38 245 KRAVL---DGPNVktLHDYAYYWPHFSPITHPVDEDLSLFSLSKTTGHAGSRFGWGLVKDKAIYEKMDRFIRLTSMGVSK 321 thale cress
Q9LR29 175 REPVVn--RREGGkvIHDLAYYWPHYTPITRRQDHDLMLFTFSKITGHAGSRIGWALVKDIEVAKKMVHYLTINSIGVSK 252 thale cress
O04927 242 RKAMI---VGSTA--IYDMVYYWPHFTPITYKADEDIMLFTMSKYTGHSGSRFGWAIIKDENVAIKLVEFMSKNTEGTSR 316 Allium tuberosum
Q94A02 228 RESVV---NSTEGilIHDLAYYWPQYTPITSPADHDVMLFTASKSTGHAGIRIGWALVKDRETARKMIEYIELNTIGVSK 304 thale cress
Q8LL95 213 REAVLs-sDSSKGkaIHDLVYYWPQYTPITSPAVHDIMLFTMSKLSGHGGTRLGWALVKDSDVAKKMVYFVYGSTIGVSK 291 Aegilops tauschii
3BWO_D 254 ESQVRTAKILNVLKETCKSESes---eNFFKYGREMMKNRWEKLREVVKESD-AFTLPKY-PEAFCNYFGKSLESYPAFA 328 thale cress
Q942G4 341 ETQLRVLKILKVILANLHGKE------DIFAFGYDVMSSRWRRLNAVVSRST-RISLQKM-PPQYCTYFNRIKEPSPAYA 412 Japanese rice
Q76BK3 332 ETQLRTLKLIKEILLQIKTKRgt--mgDINEFGYQALRKRWIELSKLVSSSN-RFSLQKL-APEYCNYFKKIRDPSPSYG 407 onion
Q9M7L9 329 ESQLRTLFIIKEILLQIKLNRgt--igDFNWYGHHTLRARWVQLNRLVAQST-RFSLQEI-SAEYCNYFQRIRNPSPTYG 404 onion
Q43366 322 ETQLRSLKILKEVIAMVKTQKgt--mrDLNTFGFQKLRERWVNITSLLDKSD-RFSYQKLpQSEYCNYFRRMRPPSPSYA 398 onion
Q93Z38 322 ETQLHVLQLLKVVVGDGGNE--------IFSFGYGTVKKRWETLNKIFSMST-RFSLQTI-KPEYCNYFKKVREFTPSYA 391 thale cress
Q9LR29 253 ESQTRATTILNELTKTCRTQSe-----sFFEYGYEKMKSRWERLREVVESGD-AFTLPNY-PQDFCNFFGKTLSTSPAFA 325 thale cress
O04927 317 ETQLRTLILLKEVIAMIKTHKgt--pkDINFFGFQHLRQRWEKVTELLDQSNkRFSYQHLnQSEHCNYMRMKRPPSPSYA 394 Allium tuberosum
Q94A02 305 DSQLRVAKVLKVVSDSCGNVTgk----sFFDHSYDAMYERWKLLKQAAKDTK-RFSVPDF-VSQRCNFFGRVFEPQPAFA 378 thale cress
Q8LL95 292 DSQLRAAKILGVVSDAYEPGPgdgtqlRLFDFARRRTGERWRALRAAVAATG-TFSLPDE-ITGYCNFTKQTVAAYPAFA 369 Aegilops tauschii
3BWO_D 329 WLGTKEET--DLVSELR-RHKVMSRAGERCGSDKKHVRVSMLSREDVFNVFLERLANMK 384 thale cress
Q942G4 413 WVKCEWVEddDCYETLL-AAGINSLTGTVNEAGTRYTRLSLIKTQDDFDMLLERITEFV 470 Japanese rice
Q76BK3 408 WLKCEWKEdtDCEAVLR-NGQIKTQSGVLFEADSRYTRLSLIKTQDDFDQMIQKLKPLV 465 onion
Q9M7L9 405 WLKCEWEEdtDCAAVLS-NGKILTQSGVLFEASSRYARLSIIKTQDDFNQLMERLSVLV 462 onion
Q43366 399 WVKCEWEEdkDCYQTFQ-NGRINTQNGEGFEAGSRYVRLSLIKTKDDFDQLMYYLKNMV 456 onion
Q93Z38 392 WVKCERPEdtNCYEIFR-AAKITGRNGNVFGSEERFVRLSLIRSQDDFDQLIAMLKKLV 449 thale cress
Q9LR29 326 WLGYKEER--DLGSLLK-EKKVLTRGGDRCGCNKRYVRVSMLSRDDDFDVSLQRLATIK 381 thale cress
O04927 395 WVRCNWPGeeNCSEVFK-EGGIITQDGPRFEAGSQYVRLSLIKTNDDFDQMMDHLKKMI 452 Allium tuberosum
Q94A02 379 WFKCE-EGivDCEKFLReEKKILTKSGKYFGDELSNVRISMLDRDTNFNIFLHRITSSF 436 thale cress
Q8LL95 370 WLRCHKDGveDCAEFLR-GHGIVARGGEQFGGDARCVRVNMLDRDAVFNVLIQRLSSIT 427 Aegilops tauschii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap