3JZL


Conserved Protein Domain Family
Met_gamma_lyase

?
pfam06838: Met_gamma_lyase 
Methionine gamma-lyase
This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.
Statistics
?
PSSM-Id: 399669
Aligned: 14 rows
Threshold Bit Score: 709.872
Threshold Setting Gi: 260656447
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3JZL_A   5 IQAIRKKVETQIDDLQNKTDEIAEFNQAKVLDAFQENKVSDFHFHPSTGYGYDDEGRDTLERVYATVFKTEAALVRPQII 84 
P94479  11 LKKTAMEVEADIAGIHKQIEEISERNEWRVLQSYRKHKVSDTHFTPSTGYGYDDIGRDTLESIYADVFGGEAGLVRPQII 90  Bacillus subtilis sub...
Q8Y7I1   4 IQAMRKKVEVQIADLQNETDEIAEFNQAKVLDAFQENKVSDFHFHPSTGYGYDDEGRDTLEHVYATVFKTEAALVRPQII 83  Listeria monocytogenes
Q9KAC8  11 IEKAKRNAEQKIVSNVEHVEHIALVNQKRVLDAFKRKQVSEHHFTPSTGYGYDDLGRETLEAVYADVFGAETALVRPQII 90  Bacillus halodurans
Q5HPN4   4 fSNLVEKVENTLIPYFRKIEKRALFNQEKVLNAFHHVKASESDLQGSTGYGYDDFGRDHLEQIYAHTFKADDALVRPQII 83  Staphylococcus epider...
Q8EQP5   1 MESLIEQAEQDCSLQQKDIQKNVEINQKRVLNAFRHHRISDSHLQGTTGYGYDDIGRDSLEAVYAEVFGGEDALVRPQLV 80  Oceanobacillus iheyensis
Q8DHD9  26 RTSLLTAAQGALVTRFAEIDGRVKKNLDRVLAAFRQHRLGVHHFSSMTGYGHGDLGREVLDRVFAQVMGAEAALVRVQFV 105 Synechococcus elongatus
Q55407   3 YSSFLKQAEENLVPIFSEIDAKVKENLYKVIEAFRHHRVGVQHFAGVSGYGHDDLGRDTLDGVFAQVMGAESAAVRVQFV 82  Synechocystis sp. PCC...
Q54763   3 TPQLVSEAEAELLQIFVGLDVQVKENLGRVLEAFRAERVGVHHFAGVSGYGHDDLGRETLDRLYARVFGAEAAAVRIQFV 82  Synechococcus elongat...
Q97I22  19 VLELYERALNDVEKEFKYYDEIREYNQLKVLKAFQEERISESHFTNSSGYGYNDIGRDSLDRVYANIFNTESAFVRPHFV 98  Clostridium acetobuty...
3JZL_A  85 SGTHAISTVLFGILRPDDELLYITGQPYDTLEEIVGIRKQ-GQGSLKDFHIGYSSVPLLEnGDVDFPRIAKKXT--PKTK 161
P94479  91 SGTHAISIALFGVLRPGDELLYITGKPYDTLEEIVGVRGGeNAGSLKDFQIGYNAVDLTKdGKIDYDAVAAAIN--PKTK 168 Bacillus subtilis sub...
Q8Y7I1  84 SGTHAISTVLFGILRPDDELLYITGQPYDTLEEIVGMRNQ-GQGSLKDFHIGYSSVPLLEnGDVDFPLIAEKMT--RKTK 160 Listeria monocytogenes
Q9KAC8  91 SGTHAIATVLFGLLRPGDELLYITGKPYDTLEEVIGIRGEeGGGSLKDFGITYHAVPLTAeQKVDKAAVKAAMN--ERTK 168 Bacillus halodurans
Q5HPN4  84 SGTHAITLALQSTLKNNDELLYITGSPYDTLLEVIGINGN-GVESLKEYGVRYNEVELRD-GRIDIPKVITAIN--DNTK 159 Staphylococcus epider...
Q8EQP5  81 SGTHAITTALFGVLRPGDELVYITGKPYDTMEEVIGKPGK-QEGSLHDFNIGYREIPLLAdGSVNYKQVKESWT--SNTK 157 Oceanobacillus iheyensis
Q8DHD9 106 SGTHAIATALFGVLRPGDELISLAGPPYDTLEEVIGLRGQ-GQGSLKDFGIHYRELPLLAsGEPDWGAIATCVQ--PQTR 182 Synechococcus elongatus
Q55407  83 SGTHAIACALYGILRPGDELLSAVGSPYDTLEEVIGLRGS-CQGSLADFNISYRQLPLTAaGTVDWQGLETAVR--PETR 159 Synechocystis sp. PCC...
Q54763  83 SGTHAIAAALFGVLRPGDELLAIAGAPYDTLEEVIGTRGE-GQGSLKDFGVSYRELALTEsGEVDWQALTTAIR--PNTR 159 Synechococcus elongat...
Q97I22  99 NGTHAIGAALFGNLRPNDTMMSICGMPYDTLHDIIGMDDSkKVGSLREYGVKYKMVDLKD-GKVDINTVKEELKkdDSIK 177 Clostridium acetobuty...
3JZL_A 162 XIGIQRSRGYADRPSFTIEKIKEXIVFVKNINPEVIVFVDNCYGEFVEYQEPPEVGADIIAGSLIXNPGGGLAKTGGYIA 241
P94479 169 VIGIQRSKGYANRPSFLISEIKEMIRFVKEINENLIVFVDNCYGEFVEELEPCHVGADLMAGSLIKNPGGGLAKTGGYLV 248 Bacillus subtilis sub...
Q8Y7I1 161 MIGIQRSRGYADRPSFTIDKIKEMIIFVKNINPEVIVFVDNCYGEFAEYLEPTEVGADIIAGSLIKNPGGGLAKTGGYIA 240 Listeria monocytogenes
Q9KAC8 169 VIGIQRSKGYADRPSFSINEIEQMVQFVKGINPNVIVFVDNCYGEFVEAKEPCHVGVDVIAGSLIKNPGGGIVKTGGYVA 248 Bacillus halodurans
Q5HPN4 160 VVAIQRSKGYDQRPSITINEIEQAITSIKEVYPNIIIFVDNCYGEFVEDKEPIEVGADLIAGSLIKNPGGGLAKIGGYIA 239 Staphylococcus epider...
Q8EQP5 158 VIAIQRSKGYDERPSYTVDQISEMIQFVKGIDPSVIVFVDNCYGEFTETKEPLHVGADLMAGSLIKNPGGGLVRAGGYIA 237 Oceanobacillus iheyensis
Q8DHD9 183 MVLIQRSCGYTWRPSLSLEDIGKMIQLIKSQNPDVVCFVDNCYGEFVETQEPPHVGADLIAGSLIKNPGGTIATAGGYLA 262 Synechococcus elongatus
Q55407 160 LVLIQRSCGYSWRPSLAIADIARIIEIVKAQNPRTLCFVDNCYGEFIETVEPTAIGVDLMAGSLIKNPGGTIVTAGGYLA 239 Synechocystis sp. PCC...
Q54763 160 LALIQRSCGYSWRRSLSIDDIARIVALVKSQNPDTVCFVDNCYGEFIETREPTMVGADLMAGSLIKNPGGTIAPAGGYVA 239 Synechococcus elongat...
Q97I22 178 LIHIQRSTGYGWRKSLRIAEIAEIIKSIREVNENVIVFVDNCYGEFVEEKEPTDVGADIIAGSLIKNIGGGIATTGGYIA 257 Clostridium acetobuty...
3JZL_A 242 GKEALVDLCGYRLTTPGIGREAGASLYSLLEXYQGFFLAPHVTAQAIKGARFTAAXLAEFGVEADPVWDAPRTDLIQSVS 321
P94479 249 GKAKWIEACSYRMTSPGIGREAGASLYSLQEMYQGFFLAPHVVSQSLKGAVFTARFLEKLGFTSNPKWDAKRTDLIQSVE 328 Bacillus subtilis sub...
Q8Y7I1 241 GKEALIDLCGYRLTTPGIGREAGASLYSLLEMYQGFFLAPHVTAQAIKGARFTAAMLAEFGVVADPTWDAPRTDLIQSIS 320 Listeria monocytogenes
Q9KAC8 249 GKAPYVKQASYRLAAPGIGTEGGATLYSLLEMFQGLFLAPHVVSQAVKGAHFTAAFLDELGMRTSPRYDEQRTDLIQSVQ 328 Bacillus halodurans
Q5HPN4 240 GRQDLIERCGYRLTAPGIGKEAGASLNSLQEMYQGFFLAPHVVSQSLKGALFTSLLLEKINMKTSPKYNVYRTDLIQTVQ 319 Staphylococcus epider...
Q8EQP5 238 GNKELIHLCANRLTAPGLGKETGASLGMLQEMYQGFFLAPHTVGEALKGAILTARFLELAGFNTSPSYLEKRTDLIQTVI 317 Oceanobacillus iheyensis
Q8DHD9 263 GRADLIEQASYRLTAPGIGHEGGATFDQHRLLFQGLFLAPQMVGEALKCAHLLAYVFDELGYPVNPAPLSRRRDVIQAVQ 342 Synechococcus elongatus
Q55407 240 GKEEWVEAGAYRLTAPGIGREGGATFDQNRLLFQGLFLAPQMVGEAMKCNHLLAHVFDQLGYPVNPAPLSPRRDVIQAIQ 319 Synechocystis sp. PCC...
Q54763 240 GRADLVEAAACRLTAPGIGSSGGATFDQNRLLFQGLFLAPQMVAEAMKGSHLIAWVCDRLGYPVQPDPWEPRRDVIQAVR 319 Synechococcus elongat...
Q97I22 258 GKEEYVTQATFRVTVPGIGGECGSTFGVMRSLYEGLFMAPHVTIEAVKGAVFCARIMELAGFDVLPKYNDKRTDIIQAIK 337 Clostridium acetobuty...
3JZL_A 322 FHNKEKXVAFAQAIQAASPVNAHVLPIGAYXPGYEDDVIXAAGTFIQGASLELTADGPIREPYQLYVQGGLTYEHIKIAV 401
P94479 329 FSDREKMIAFCQAIQFASPINAHVTPYPAYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKNAI 408 Bacillus subtilis sub...
Q8Y7I1 321 FHNKEKMVAFAQAIQAASPVNAHVLPIGAYMPGYEDDVIMAAGTFIQGASLELTADGPIREPYQLYVQGGLTYEHVKIAV 400 Listeria monocytogenes
Q9KAC8 329 FPDREKMIAFCQAIQAASPIDAHVTPQPSSMPGYEDPVIMAAGTFIQGASIELTADGPVRPPYIAYVQGGLTYEHVKLAV 408 Bacillus halodurans
Q5HPN4 320 FETKEQMISFCQSIQHASPINAHFSPEPSYMPGYEDDVIMAAGTFIQGSSIELSADGPIRPPYEAYVQGGLTYEHVKLAV 399 Staphylococcus epider...
Q8EQP5 318 FDEADQMIAFCQSIQENSPINSYVKPYPSDMPGYEDQVIMAAGTFIQGSSIELSADGPIRAPYTAYVQGGLTYTHVKIAL 397 Oceanobacillus iheyensis
Q8DHD9 343 LGSPEKLIAFCRILQRYSPVGSYLDPVPAPMPGYADDLVMAGGTFIDGSTSELSADGPLRPPYIVFCQGGTHHTHMALIL 422 Synechococcus elongatus
Q55407 320 LGSPEKLLAFCRALQGASPISSYLQPVPAAMPGYASEVVMAGGTFIDGSTSELSADGPLREPYTVFCQGGTHWTHMAIAL 399 Synechocystis sp. PCC...
Q54763 320 LGSAEKLVAFCRAIQQHSPIGAYLDPVPAPMPGYESDLVMAGGTFIDGSTSEFSADGPLREPYTVFCQGGSHHAQVAIAL 399 Synechococcus elongat...
Q97I22 338 FNDEKKLIDFIKGIQTASPVDSFVQCEAWDMPGYEDKVIMAAGTFVQGASIELSADAPIREPYIGYLQGGLTFDHAKLGV 417 Clostridium acetobuty...
3JZL_A 402 TRAIQKIV 409
P94479 409 CSAVDSLM 416 Bacillus subtilis subsp. subtilis str. 168
Q8Y7I1 401 TRAIQKTL 408 Listeria monocytogenes
Q9KAC8 409 MQAADEML 416 Bacillus halodurans
Q5HPN4 400 TRAVQHMq 407 Staphylococcus epidermidis RP62A
Q8EQP5 398 LEAVKSLK 405 Oceanobacillus iheyensis
Q8DHD9 423 EALLEAQV 430 Synechococcus elongatus
Q55407 400 EEILAAFE 407 Synechocystis sp. PCC 6803
Q54763 400 EAAIAAIG 407 Synechococcus elongatus PCC 7942
Q97I22 418 LIALSKLI 425 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap