3EZ1


Conserved Protein Domain Family
Aminotran_MocR

?
pfam12897: Aminotran_MocR 
Click on image for an interactive view with Cn3D
Alanine-glyoxylate amino-transferase
These proteins catalyze the reversible transfer of an amino group from the amino acid substrate to an acceptor alpha-keto acid. They require pyridoxal 5'-phosphate (PLP) as a cofactor to catalyze this reaction. Trans-amination reactions are of central importance in amino acid metabolism and in links to carbohydrate and fat metabolism. This class of aminotransferases acts as dimers in a head-to-tail configuration.
Statistics
?
PSSM-Id: 403948
Aligned: 4 rows
Threshold Bit Score: 732.436
Threshold Setting Gi: 81551172
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3EZ1_A          3 TKEASRPALDLARQAYEAFKARGLNLNXQRGQPADADFDLSNGLLTVLGAEDVRX-DGLDLRNYpGGVAGLPSARALFAG 81  Deinococcus ge...
Q9RU17         29 TSSATPDALAQAQAAYAELKARGLKLNLQRGQPADADFDLSNPMLSVLGENDTRY-DGTDLRNYpGGVAGLPSARALFGN 107 Deinococcus ra...
jgi:Tpau_4021   8 SQSELADVHATLTGLYETLKAQGLTLDLTRGKPAPDQLDLSNALLALPGEGDYRAaDGTDTRNY-GGLAGLPELRAIFGE 86  Tsukamurella p...
CAN96406        8 SPDALASLTRELEARFAAFEARGLKLDMTRGKPSSEQLDLANGMLALPGAGDLVAsDGSDTRNY-GGLDGLPEMKAIFAE 86  Sorangium cell...
3EZ1_A         82 YLDVKAENVLVWNNSSLELQGLVLTFALLHGVRGSTGPWLSQ-TPKXIVTVPGYDRHFLLLQTLGFELLTVDXQSDGPDV 160 Deinococcus ge...
Q9RU17        108 YLDLKPENVLVWNNSSLELQGLVLGFALLHGLRGSQGGWVHE-KPKMIVTVPGYDRHFLLLETLGFKLLAVDMQDDGPDV 186 Deinococcus ra...
jgi:Tpau_4021  87 LLGIPTANLYAQNNSSLEIMHRLITLAWIHGTVDGERPWGAEeTVKFLCPAPGYDRHFAITEELGIEMIVVPLNPDGPDM 166 Tsukamurella p...
CAN96406       87 MLEVPSEQVIVGGNSSLTMMHDAVVRALLHGVPDGSGPWVKQpKVKFLCPSPGYDRHFAICEHHGIEMITVDLRDDGPDM 166 Sorangium cell...
3EZ1_A        161 DAVERLAGTDPSVKGILFVPTYSNPGGETISLEKARRLAGLQAAAPDFTIFADDAYRVHHL-VEEDRAEpvNFVVLARDA 239 Deinococcus ge...
Q9RU17        187 DAIERLAANDASVKGILFVPTYSNPGGETISAEKARRLVGLKAAAPDFTIFADDAYRAHHLfGEGERDVpvNFVALCRDA 266 Deinococcus ra...
jgi:Tpau_4021 167 AVVKELVAKDPSIKGIWAVPKFSNPTGSVFSEEVTRELASMPTAAPDFRIFWDNAYAVHALvGDAPSDP--DILGLAAEA 244 Tsukamurella p...
CAN96406      167 DQVEKLVAEDAAIKGMWSVPKYSNPTGTTYSPEVVRRLAAMKTAAPDFRLFWDNAYAVHDLyAEGDKLA--NIVPACQSA 244 Sorangium cell...
3EZ1_A        240 GYPDRAFVFASTSKITFAGAGLGFVASSEDNIRWLSKYLGAQSIGPNKVEQARHVKFLTEYPgGLEGLXRDHAAIIAPKF 319 Deinococcus ge...
Q9RU17        267 GHPDRAFVFASTSKITFAGAGLGFVGSSEDNIGWLGKYLGAQSIGPNKFEQARHVKFLEGYDgGLEGLMRDHAALIAPKF 346 Deinococcus ra...
jgi:Tpau_4021 245 GHPNRPYVLASTSKITFAGAGVSFFGASAENLAWYGKYTGLTSIGPDKVNQLRHVRFFGDAE-GVRAHMRRHRDLIAPKF 323 Tsukamurella p...
CAN96406      245 GHPNRPIVFASTSKISFAGSGVAAMASSPANVADAKKHLGIQTIGPDKVNQLRHVRFYKDYK-GLLSHMQRHAELMRPKF 323 Sorangium cell...
3EZ1_A        320 RAVDEVLRAELGe-GGEYATWTLPKGGYFISLDTAEPVADRVVKLAEAAGVSLTPAGATYPAGQDPHNRNLRLAPTRPPV 398 Deinococcus ge...
Q9RU17        347 QAVYDALSAGLGegGGGYATWRTPRGGYFISLDTVDPVAERVVQLADEAGISLTPAGATYPGGNDPKNANIRLAPTRPPL 426 Deinococcus ra...
jgi:Tpau_4021 324 ARVLEILEDRLA--AAKVASWSEPTGGYFISLDVLDGTAKRTVALAKEAGIALTAAGATFPHGEDPHDRNIRLAPTFPSI 401 Tsukamurella p...
CAN96406      324 EAVTTTFERELG--GKGIATWTSPRGGYFVSLDTLDGCAKEVVRLANKAGVKLTGAGATYPYGRDPRDRNIRVAPSMPPL 401 Sorangium cell...
3EZ1_A        399 EEVRTAXQVVAACIRLATEEYRAG-H 423 Deinococcus geothermalis DSM 11300
Q9RU17        427 AEVEEAMRGVATCVKLAAEEYRAGqH 452 Deinococcus radiodurans
jgi:Tpau_4021 402 AELETAMDGVATCVLLASAEKLMQqQ 427 Tsukamurella paurometabola DSM 20162
CAN96406      402 EQIRVAMDVVAVCVQLASVRKLAG-- 425 Sorangium cellulosum So ce56
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap