2LWL,5KI9


Conserved Protein Domain Family
Defensin_beta_2

?
pfam13841: Defensin_beta_2 
Beta defensin
The beta defensins are antimicrobial peptides implicated in the resistance of epithelial surfaces to microbial colonisation.
Statistics
?
PSSM-Id: 404686
View PSSM: pfam13841
Aligned: 97 rows
Threshold Bit Score: 30.4071
Threshold Setting Gi: 1212215541
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2LWL_A         9 KCNKL-KGTCKNNCGKNEELIALCQKSLKCC 38 
Q30KN7        28 KCWKNsLGYCRVRCQEEERYIYLCKNKVSCC 58  house mouse
Q32ZG6        28 KCWKDnLGRCRVRCRGDERYIYLCRNKANCC 58  Norway rat
PNJ57306       6 KCWKNnIGHCRRRCLDTERYILLCRNKLSCC 36  Sumatran orangutan
NP_001123446  25 RCWRYnIGHCRRRCLHLERYKHLCMNKRACC 55  pig
Q30KS9        26 RCWKDnIGHCRKRCFHVERYKLLCMNKLICC 56  dog
EFB14918      15 KCQQG-YGICRERCRHDETETHFCRNKGKCC 44  giant panda
Q30KL1        39 PCELY-QGMCRNACREYEIQYLTCPNDQKCC 68  chimpanzee
Q8BGW9        39 aCELY-QGLCRNACQKYEIQYLSCPKTRKCC 68  house mouse
Q8NET1        27 ICERP-NGSCRDFCLETEIHVGRCLNSQPCC 56  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap