6UE7


Conserved Protein Domain Family
Ig_J_chain

?
pfam15097: Ig_J_chain 
Immunoglobulin J chain
Statistics
?
PSSM-Id: 405738
View PSSM: pfam15097
Aligned: 11 rows
Threshold Bit Score: 227.702
Threshold Setting Gi: 124271
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6UE7_D         2 EDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVELDN 81 
P23108         1 EDESTVLVDNKCQCVRITSRIIRDPDNPSEDIVERNIRIIVPLNTRENISDPTSPLRTEFKYNLANLCKKCDPTEIELDN 80  rabbit
XP_016278433  29 EDEGRILVDNKCKCVRVTSRLVPSKDNPEEKVVERNIRLIVPLRNRENISDPTSPVRTRFVYRLSDLCKKCDPTELELNN 108 gray short-tail...
XP_003430954  27 gDDGDVLVDNKCKCTRVTSKFVPSKEDPSVKVLERNIRVIIPLKARQNISDPTSPPRTRFVYELSKLCQKCDQTEVELDH 106 platypus
XP_003221879  67 hDQEKVLVDNKCQCVKVTSKFVASKDDPDNEVLVRNIRIVVPLTARENISDPTSPVRTKFVYKLSKLCDNCHSSGNPENG 146 green anole
NP_001296431  28 qDEEYVLVNNKCQCVTVTSKFVPSKEDPEEEVLERNIRIIVPLKARENISDPLSPPRTTFVYRLSELCRNCEPVEIDLGG 107 zebra finch
BAB83927      26 DGEERVLVNNKCKCVTVTSKFVPSKDNPEEEVLERNIRIIVPLKSRENISDPTSPLRTTFVYRMTELCKKCDPVEIELGG 105 chicken
XP_011223657  25 EDGRTVLVDNKCQCARITSRIIPSPEDPNEDIVERNIRIIVPLNNRENISDPTSPVRTKFVYHLSDLCKKCDPVEVELGN 104 giant panda
XP_006094475  25 EDERTVLADNKCKCARVTSRVIPSPDDPTQEIVERNIRIIVPVNNRENISDPTSPLRTKFVYHLSEMCKKCDTTQVELEN 104 little brown bat
Q3SYR8        24 DENERIVVDNKCKCARITSRIIPSAEDPSQDIVERNVRIIVPLNSRENISDPTSPMRTKFVYHLSDLCKKCDTTEVELED 103 cattle
P01592        23 DDEATILADNKCMCTRVTSRIIPSTEDPNEDIVERNIRIVVPLNNRENISDPTSPLRRNFVYHLSDVCKKCDPVEVELED 102 house mouse
6UE7_D        82 QIVTATQSNIC---DEDSatETCYTYDRNKCYTAVVPLVYGGETKMVETALTPDACYPD 137
P23108        81 QVFTASQSNICp-dDDYS--ETCYTYDRNKCYTTLVPITHRGGTRMVKATLTPDSCYPD 136 rabbit
XP_016278433 109 EVVTATQSNNC---DDTS--ETCYTYDRNKCYTSTAALYLEGETRLVTTALTPESCYND 162 gray short-tailed opossum
XP_003430954 107 EVVTATRGNSC---DRPG--DDCYTYDRNKCYMSTIPFTYGGETKVVNTVLTPESCYPD 160 platypus
XP_003221879 147 QRV--GESGLC---NDPQ--EPCYTYDRNKCYTAPCLFNNAGKTETIETALTPESCYDD 198 green anole
NP_001296431 108 VIYHAQQGNSC----EEP--QTCYTYDRNECYSSPVPLLYHGEVRQVPAALTPASCFTE 160 zebra finch
BAB83927     106 ETYQAQQSNSC----NEP--ETCYTYNRDKCYTTTFPFVYHGETKHIQAALTPTSCYAE 158 chicken
XP_011223657 105 QIVIASQSNLC---DEDS--ETCYTYDRNKCYTNRVPFTYGGQTRMVETALTPDSCYPD 158 giant panda
XP_006094475 105 QVVTATQSNIC---DEDN--ETCYTYDRNKCYTNKVPFSYGGKTVMVETALTPESCYPD 158 little brown bat
Q3SYR8       104 QVVTASQSNIC---DSDA--ETCYTYDRNKCYTNRVKLSYRGQTKMVETALTPDSCYPD 157 cattle
P01592       103 QVVTATQSNICnedDGVP--ETCYMYDRNKCYTTMVPLRYHGETKMVQAALTPDSCYPD 159 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap