Conserved Protein Domain Family
RAD51_interact

?
pfam15696: RAD51_interact 
RAD51 interacting motif
This motif interacts with RAD51.
Statistics
?
PSSM-Id: 406187
View PSSM: pfam15696
Aligned: 19 rows
Threshold Bit Score: 52.3123
Threshold Setting Gi: 344242399
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007503820  332 ASSGGSSNPLGGVSVRSPSHSLRLGLSRFARVKPLHPTA 370  gray short-tailed opossum
XP_004007263 1114 AGSSFSYGISRVLPLKTCGRPIRIGLSRKAKLKQLHPYL 1152 sheep
XP_003734836 1106 RGSYFPHGISRVRPLKTCSRPIRIGLSRKARVKQLHPYL 1144 white-tufted-ear marmoset
4_pfamImport    1 -GSLLSNGIVRLYPLKTCSGPIRIGLSRRAKAKQLHPYL 38  
XP_006225792 1042 GGSHVSHGISRVQPLKTCSRPIRVGLSRRARLKQLHPYL 1080 Norway rat
EGV98502      292 GSRSSSSSPLAAASTKSPSQSLRLGLSRLAPVKRLHPNV 330  Chinese hamster
Q8C551        293 GSRNSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSA 331  house mouse
ELK02576      290 GSSSNSSNPLAGVSVKSPNQSLRLGLSRLARVKPLHPNA 328  black flying fox
XP_508941     294 GGSRSSSSPLVVVSVKSPNQSLRLGLSRLARVKPLHPNT 332  chimpanzee
EDO42727      295 KNSSSPSLGLGGVQIKSPAVPLRLGLSRNARVKPLHSNV 333  starlet sea anemone
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap