2ZKR,1VW8,1VX7,4A17


Conserved Protein Domain Family
Ribosomal_L26

?
pfam16906: Ribosomal_L26 
Ribosomal proteins L26 eukaryotic, L24P archaeal
Ribosomal_L26 is a family of the 50S and the 60S ribosomal proteins from eukaryotes - L26 - and archaea - L25.
Statistics
?
PSSM-Id: 407140
Aligned: 105 rows
Threshold Bit Score: 116.063
Threshold Setting Gi: 947068678
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ZKR_TT              8 TSDRSKNRKRHFN-APSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQi-GKVVQVYRKKYVIYIERV 85 
licsiro:TALC_01323   3 SSKARVQRKAQYN-APAHTKRKMLSAHLSKELAEKYGRRTARVCVGDTVAVVRGEEKVKGveAKVIEVFTKTGRVSIDGV 81  Thermopla...
B1L777               5 SHKPSKQRKYLYN-APIHHRGKIMSAPLSEELKSKYGINSIPIRKGDRVKVMRGDYRGTE--GEVISVDRKRYRIAVKGI 81  Candidatu...
A1RWS4               6 SSKPGKVRKREVYdAPLHIRSKKIVAPLSAELQQKLGIKRIRVRKGDRVLIVRGSFKGHE--GKVTSVDVKKGRIHVEGA 83  Thermofil...
CBRAS:FFONT_0509     6 SIKPKKQRKILFN-APLHIREKLVTSPLSKELRNKYGIKRLPVRSGDTVKIMRGNNAGLE--GKVVKVNRKTGRVHIEKV 82  Fervidico...
WP_013775657         3 SSKPTKQRKMLFS-APYHLRRKMLTAMVSEEITKEYGIKRIEVKKGDTVKVMRGDNVGFE--GKVAQVNTKTGRIAIEGL 79  Acidianus...
Q9UX95               3 SLKPSKQRKLLYT-LPLHQRKKLLVAKVSDDIASQYGIKRIRVRKGDTVRVMRGGNSGKE--GKVVEVNTKTGRLAIEGI 79  Saccharol...
Q975J1               3 SHKPSKQRLLLYN-LPKHQRHKLLTAKLSKELQQQYGIKRLAIRKGDTVKVMRGDKDVLNfeGKVVEVNRKTGRIAIEGL 81  Sulfurisp...
O05633               3 SSKPSKQRKLVYN-LPNHLRYKLLTARLSEDLEKQYGIKRISIRKGDSVKLMRGSQVGYE--GKVVEVDRKRGRVAIEGL 79  Sulfolobu...
WP_020448350         4 SSKTRKQRKAFYN-APAHIRRKMVSSHLSDELRKDFGIHAAQVVKGDTVRVMRGDEDVVDveGKVTQVDTRSGRLVIENV 82  Candidatu...
2ZKR_TT             86 QREKANGTTVHVGIHPSKVVITRLKL-DKDRKKILERK 122
licsiro:TALC_01323  82 TINQADGTAVARPIHASNLVITKLNLdDPLRAEALNNK 119 Thermoplasmatales archaeon BRNA1
B1L777              82 VRRKADGTEVPVPIHPSKVVITKLYLkDEARKRLLERK 119 Candidatus Korarchaeum cryptofilum OPF8
A1RWS4              84 TLRKADGTEVPFPIHPSKVVVTELDLsDPRRKELVERK 121 Thermofilum pendens Hrk 5
CBRAS:FFONT_0509    83 TRDRADGTPVFIPIHASKVMITKLDLsDKERKQIIERK 120 Fervidicoccus fontis Kam940
WP_013775657        80 TRKKADGTPVYIWIHASKVMITKLDLsDNKRKASIERK 117 Acidianus hospitalis
Q9UX95              80 TRKKVDGTPVYVWIHASKVMITKLDLsDPRRREKLEKS 117 Saccharolobus solfataricus P2
Q975J1              82 TRKKADGTPVYRWIHASKVIITKLDLsDAKRKEIIERK 119 Sulfurisphaera tokodaii str. 7
O05633              80 TKKKADGTPVYVWVHASKVIITKLDTgDKERMDAIERK 117 Sulfolobus acidocaldarius DSM 639
WP_020448350        83 TISKADGTLVARPIHASKVEITKLNLsDPMRKQTLSKK 120 Candidatus Methanomassiliicoccus intestinalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap