Conserved Protein Domain Family
CxC7

?
pfam18866: CxC7 
CxC7 like cysteine cluster associated with KDZ transposases
A predicted Zinc chelating domain present N-terminal to the KDZ transposase domain.
Statistics
?
PSSM-Id: 408636
Aligned: 3 rows
Threshold Bit Score: 135.12
Threshold Setting Gi: 688551695
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_001121769 105 NWSRFSEDYKKEFRVPCSLTECPKCGDIFKDCPPGYVGDGRKGVLRGFYSTIDFPGYCLAECHF 168 zebrafish
XP_009299211 123 DWSRFSEDYKKEFRVPYSLTECPECGDIFKDCPPGYVGDGRKGVLRGFYSTIDFPGYCSAECHF 186 zebrafish
XP_009299211 123 DWSRFSEDYKKEFRVPYSLTECPECGDIFKDCPPGYVGDGRKGVLRGFYSTIDFPGYCSAECHF 186 zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap