Conserved Protein Domain Family
CYP2W1

?
cd20671: CYP2W1 
cytochrome P450 family 2, subfamily W, polypeptide 1
Cytochrome P450 2W1 (CYP2W1) is expressed during development of the gastrointestinal tract, is silenced after birth in the intestine and colon by epigenetic modifications, but is activated following demethylation in colorectal cancer (CRC). Its expression levels in CRC correlate with the degree of malignancy, are higher in metastases and are predictive of survival. Thus, it is an attractive tumor-specific diagnostic and therapeutic target. CYP2W1 belongs to family 2 of the large cytochrome P450 (P450, CYP) superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop.
Statistics
?
PSSM-Id: 410764
Aligned: 4 rows
Threshold Bit Score: 794.002
Threshold Setting Gi: 754388586
Created: 1-Apr-2019
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
heme bindingputative
Feature 1:heme binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                            #              ##      #   #                
Q8TAV3        63 YGPVFTVHlgrqKTVVLTgFEAVKEALAGPGQELADRPPIAIFqliqrGGGIFFSSGARWRAARQFTVRALHSLgvgrep 142 human
E9Q816        66 YGPMFTIHlgsqKTVVLSgYEVVREALVGTGHELADRPPIPIFqhiqrGGGIFFSSGARWRAGRQFTVRTLQSLgvqqps 145 house mouse
XP_414762     67 YGPVFTVHlgmqQVVVLSgYEAVKDALLNTADVFADRPPIPIFhqiqhGNGVFFSSQELWKTTRRFTLAVMRDLgmgkrl 146 Gallus gallus
XP_018426031  72 YGPIFTIHlgmkKAVVLTgLETIKESLVEAGDTFSDRATLPIFyaiqhGNGVFFTSGEMWRTTRRFTITSMKNLgmgkrt 151 Nanorana parkeri
Feature 1                                                                                        
Q8TAV3       143 vADKILQELKCLSGQLDGYrgrpfPLALLGWAPSNITFALLFGRRFDYrdPVFVSLLGLIDEVMVLLGspglqlfnvypw 222 human
E9Q816       146 mVGKVLQELACLKGQLDSYggqplPLALLGWAPCNITFTLLFGQRFDYqdPVFVSLLSLIDQVMVLLGspgiqlfntfpr 225 house mouse
XP_414762    147 aEERMLEELQFLIELIKSFqggpfRLRLLNAAPTNITFAMLFGRRFDYgdPTFVTLLRLIDEVMLLLGspflhlfnfypf 226 Gallus gallus
XP_018426031 152 iEDKIVEELQFLNDKIQSFngkhfKLREFVCAPTNITFAMIFGNRFDYkdPTYMRILDLIDDIVVLLGspylqifnlypv 231 Nanorana parkeri
Feature 1                                                                                #  ##  #
Q8TAV3       223 lgallqlHRPVLRKIEEVRAILRTLLEARrphvcpgdpvCSYVDALIQQGqgddp--eglfAEANAVACTLDMVMAGTET 300 human
E9Q816       226 lgaflrlHRPVLSKIEEVRTILRTLLETRrpplptggpaQSYVEALLQQGqeddp--edmfGEANVLACTLDMVMAGTET 303 house mouse
XP_414762    227 lgfllkpHKMILKKVEEVCVILRKRIQESkanis-ennlTSYIDALVFKQeednk-sntlfHDANVLASALDLLMAGTET 304 Gallus gallus
XP_018426031 232 lgtfmktHKIILDKVDKICMVLKDDIKAKrqtid-hnclHTFIEAIIAKQeeektnkdtlfHDDNVLATVLDLVMAGTET 310 Nanorana parkeri
Feature 1        #  #                                                  #     #  # #              
Q8TAV3       301 TSATLQWAALLMGRHPDVQGRVQEELDRvlgpgrtprledqqaLPYTSAVLHEVQRFITLLPHVPRCTAADTQLGGFLLP 380 human
E9Q816       304 TAATLQWAVFLMVKHPHVQGRVQEELDRvlgpgqlpqpehqraLPYTSAVLHEVQRYITLLPHVPRCTAADIQLGGYLLP 383 house mouse
XP_414762    305 TSTTLQWAVLLMMKYPEIQKKVHAEIERvlgpdcpptfedrknMPFTNAVIHEVQRFVTLLPHVPRCTSADTRFKGYFIP 384 Gallus gallus
XP_018426031 311 TSTTLQWGILLMMKYPHIQKRVQKEIHTvlesrclpnyedrkaIPXTLAVIYEIQRFANVIPHVPHATAKDVKFKGYHIP 390 Nanorana parkeri
Feature 1                #                                   ###   # ###  ##                     
Q8TAV3       381 KGTPVIPLLTSVLlDETQWqTPGQFNPGHFldanghFVKREafLPFSAGRRVCVGERLARTELFLLFAGLLQRYRllppp 460 human
E9Q816       384 KGTPVIPLLTSVLlDKTQWeTPSQFNPNHFldakgrFMKRGafLPFSAGRRVCVGKSLARTELFLLFAGLLQRYRllppp 463 house mouse
XP_414762    385 KGTTVIPLLSSVLlDKTQWeTPDEFNPNHFldadgnFVKKKafLPFSTGRRNCIGESLATVELFIFFTGLIQKFTfkppp 464 Gallus gallus
XP_018426031 391 KGTIVIPLLSSILyDQRHWeKPYQFDPNHFldsegkFVKKEafVPFSIGRRVCVGESLAKMELFIFFTGLLQKFTfsapp 470 Nanorana parkeri
Feature 1                                  
Q8TAV3       461 --gvspASLDTTPAraFTMRPRAQAL 484 human
E9Q816       464 --glspADLDLRPApaFTMRPPAQTL 487 house mouse
XP_414762    465 --gvkeSELNMTAEagFTMRPSPQCA 488 Gallus gallus
XP_018426031 471 simkynLDLDADPC--FTLRPQPHLE 494 Nanorana parkeri

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap