Conserved Protein Domain Family
opacity_OapA

?
NF033909: opacity_OapA 
opacity-associated protein OapA
This family consists of full-length homologs to OapA, opacity-associated protein A as described in Haemophilus influenzae. OapA shares a C-terminal homology domain, called the OapA domain, with the Escherichia coli protein YtfB, which is now known to bind peptidoglycan through its OapA domain and to act as a cell division protein.
Statistics
?
PSSM-Id: 411470
Aligned: 11 rows
Threshold Bit Score: 428.889
Threshold Setting Gi: 492025418
Created: 25-Aug-2020
Updated: 28-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014064225     10 NSSQNELDLGFNHsDSVTPRKPVQQSGSIFDKAKG----LFGKKEQ--PDTQFHVRREPTFGAAASQPFSPSQAfqsent 83  Haemophilus ...
1_ncbifamImport   1 QSSQNELDLGLNQ-EPITPKKTIQPSSSILGKAKG----LFAKKNH--VQTNFQQRKEPTFGDSSTQENDPLIP------ 67 
WP_005632065     11 QSSQDELDLGLNQ-EPITPKKTIQPSSSILGKAKG----LFAKKNH--VQTNFQQRKEPTFGDSSAQENAPLIP------ 77  Haemophilus ...
WP_005627046     11 QSSQDELDLGLNQvEPITPKKVVQPSESIFDKAKG----LFAKKDH--VETNFHERKEPTFGHTSAQESAPFIS------ 78  Haemophilus ...
WP_018356248     12 NKSQNELDLGLNQaDTVTPRKPVQSNESLLDKAKGlk-dLFGRKEQ--AGTQFHVRKEPTFGESHTQQTAQPHPqsgfte 88  Rodentibacte...
WP_005698092     10 NSSQNELDLGFNHsDSVTPRKTIQQSGSIFDKAKG----LFGKKQQ--ADTQFHVRREPTFGAATSQPFSPSQTfqsenv 83  Haemophilus ...
WP_005704332     13 NPAQNELDLGFSQmEPITPKKVIKPEPSLFEKAKG----LFAKKEQknIETQFATRKEPVFGSSGAVGDTTMTS------ 82  Aggregatibac...
WP_005722584     13 NPEQSELDLEFSQvEPITPKKMAKPTPSFFDSVKG----VFAKKTShdAALK-TTRQAPAFN------EATSSS------ 75  Pasteurella ...
WP_005758701     13 NPSQKELDLGINQiEPVTPKKVYTSETSIFDKAKGgfkgIFAKKENl-SPNQFAVRKEPTFGEPSSMNPATSNIkvekai 91  Pasteurella ...
WP_005548305     13 NPAQNELDLGFSQmEPITPKKVIKPEPSLFEKLLGkgkdLLAKKEQknMENQFAVRREPVFGGAGATGEKSMTS------ 86  Aggregatibac...
WP_005558815     13 NPAQNELDLGFSQmEPITPKKAIKPEPSLFEKLLGkgkdFLAKKEQknMESQFAVRKEPVFGGAGATGEKSMTS------ 86  Aggregatibac...
WP_014064225     84 eqsasssafgyQEPVENV----------QVESVAEEKVIFENSPAEEIVE-----EVTTQAETVAPa----------aAA 138 Haemophilus ...
1_ncbifamImport  68 -----------SENLKKV----------QKPVLQTSSTEENISAVDEEIS-----AENNADEPVEK------------AE 109
WP_005632065     78 -----------SENLKTA----------QEPVLQTSSTEENISTVDEEIS-----AENNADETVEK------------AE 119 Haemophilus ...
WP_005627046     79 -----------SETLRTE----------QEPVIQIVSAEETISAVEEEIK-----TETIAEETVEQ------------AE 120 Haemophilus ...
WP_018356248     89 ------svkvtAENVEQK----------LESAVEKVETKVEN-AVESTVS-----ATEQAKETLAAga---------tAA 137 Rodentibacte...
WP_005698092     84 eqvaqasafspQEPVENV----------QVENVAEEKVIFENSPIEEVVE-----DATTQAETVAP------------AA 136 Haemophilus ...
WP_005704332     83 -----------ENQTENTtidn--nfstTHSEVHEVETSAVENSSETLTEettkaVEPSQSDISDFk----------eKP 139 Aggregatibac...
WP_005722584     76 -----------NTQTDLN--------------------------ADELTSe-----QPTSEDMGAAv----------vAP 103 Pasteurella ...
WP_005758701     92 -----eetvvkVENSSTSignesnttahEIKSEFIASTETLKSNVEPIRTepnteIPKAQSTLSEAsptnqpqhlsdnTE 166 Pasteurella ...
WP_005548305     87 -----------ENPTERFstenteskepQIAADTATETL-PEAPAEPLVTeaeeaVEATQPEPAELk----------eKP 144 Aggregatibac...
WP_005558815     87 -----------ENPTEKFstentesnepQTAADTVAETSSSESPVEPTVIeteenVETAQPEVSELk----------eKP 145 Aggregatibac...
WP_014064225    139 AASLKSPEKWKVLQMLPEKHRRLFIAILGLVVLLIIFFTLKPNSDTVESFEQQNSNEIPVQFQSLDQSQPVETTVLDNN- 217 Haemophilus ...
1_ncbifamImport 110 KPILAQPEKWKILQVLPAKHRRLFMAIFVLVILLIIFFALKPSSDTVESFTQSNSNEVPVQFQSLDQSQPLETTILDNPp 189
WP_005632065    120 KPILAQPEKWKVLQVLPAKHRRLFMAIFVLVILLIIFFALKPSSDTVESFTQSNSNEIPVQFQSLDQNQPVETTILDNPp 199 Haemophilus ...
WP_005627046    121 KRTLSQPEKWKVLQVLPTKHRRLFMAILALVILLIIFFALKPSSDTVESFTQSNSNEIPVQFQSLDQNQPVETTILDNPp 200 Haemophilus ...
WP_018356248    138 ATALKRPEKWKILQILPEKHRRLFIAILALVLLLIVFFALKPNSDTVESFEQQNSNEIPVQFQSLDQSQPVETTVLDNVp 217 Rodentibacte...
WP_005698092    137 AASLKSPEKWKVLQMLPEKHRRLFIAILGLVVLLIIFFTLKPNSDTVESFEQQNSNEIPVQFQSLDQSQPVETTVLDNN- 215 Haemophilus ...
WP_005704332    140 KAGLKNPENWAILSILQQKHRRLFVAIFAVVILLIFILWMKPSSDTVQSYERQSNNDVPIQFQQLDQSQNVESTVLDNPt 219 Aggregatibac...
WP_005722584    104 AVNWKNPETWPFLQILPQRHRRLFVALFGLILLLIIFFALKPSSQTVQSFEQQNSQAVPIQFQPLEKGQTVENTILDNLn 183 Pasteurella ...
WP_005758701    167 KAKIKNPEDWKVMQKLPRKHRRLVIAIVVALLALLALLWLKPSSDTVQDFQTGGNNNLPIEFQPLDQNQPVENADANNVv 246 Pasteurella ...
WP_005548305    145 KAGFKNPENWAILSILPQKHRRIFVALFGVVLVLIFILWMKPSSDTVQSYEQQSNNGVPIQFQQLDQSQTVEPTVLDNLt 224 Aggregatibac...
WP_005558815    146 KAGFKNPENWAILSILPQKHRRIFVALFGVVLVLIFILWMKPSSDTVQSYEQQSNNGVPIQFQQLDQSQTVEPTVLDNPa 225 Aggregatibac...
WP_014064225    218 --NTTAPATTEQTANGAKSdAPP-AMEYVGDKADAAKSQpae----paQQTVAQQPATQAPAQPTVAPTAAKDPVkt--- 287 Haemophilus ...
1_ncbifamImport 190 aqNQMAVEQANQSEFAPKAeEAAnNTTAQNPLVENAPMQqn------vVQSPSQMPNEMAAASVAPMQPAQAEQPk---- 259
WP_005632065    200 aqNQMAAEQANQPENAPKAdESAnSVTAQNQPAENMAAPqnmvapqnmAQAAVQTSNTMD--SAKPMQAAQPEPlqtqqa 277 Haemophilus ...
WP_005627046    201 aqNQMAAEQANQPENAPKAdESAnSATAQNQPAENVAEPqnmvasqnmAQAPVQTSNTMDSASAKPMQAAQPEQSqtqaq 280 Haemophilus ...
WP_018356248    218 apQENAPLAENQAQTESANtAEPgKMEYVGDQKETTGSpks-----tgVASSVNETVS----QPIPVAPARTESVkq--- 285 Rodentibacte...
WP_005698092    216 --NNAVPATTEQAANEAKSdALP-AMEYVGDKADAAKLQpae----paQQTVAQQPAT----QPAVAPAPVKEPVkt--- 281 Haemophilus ...
WP_005704332    220 ppAQPEETATQPAEGNTG--VETqNTTNTAQQAEPQ--T---------PPAMEQPT--AAENKPTEVKP-TTEGTa---- 279 Aggregatibac...
WP_005722584    184 qpADNSASATQDNTVTS--------AVTSETQPTSS------------ASGTESTPTAIAPTKVEQPVATKMGVAd---- 239 Pasteurella ...
WP_005758701    247 atQDGAAPVDASQAATP------------APETTNAP-----------QMPTTQSTPIASQITAEPVKPVTTEAPk---- 299 Pasteurella ...
WP_005548305    225 pqTDNTVAQQPAAETNT----QNvNAGAIEPQAVEQGAT---------TSVAEQTTTAAVENKPAEVKPEEVETVk---- 287 Aggregatibac...
WP_005558815    226 pqTDNTVAQQQTATAATTE-TQNtHVAGTEPQPTEQGVT---------TSVAEQATTAAVENKPTEV---PTETVk---- 288 Aggregatibac...
WP_014064225    288 -----------aQPAVEKHTATVEHKAEPHREHTPVVQEKKQPKPATEKATAQPTQTVKKEQskiQEAKPVATK-ETKVQ 355 Haemophilus ...
1_ncbifamImport 260 -----------aTVPVQPMKKAVEPQVAHKDTVKKEVKVAEKAQAPAKATEQNVAKTAGNAPi--VEAKPVQAKkEKKVQ 326
WP_005632065    278 qv--eqpkaptvVAPVPPVKKVVEQQVAHKDIAKKEVKVAEKAHVPAKATEQTVAKTAGKAPi--VEAKPVQVKkETKVQ 353 Haemophilus ...
WP_005627046    281 qaqveqpkaptvVAPVPPVKKVVEQQVAHKDIAKKEVKVAEKAHVPAKATEQTVAKTAGKAPi--VEAKPVQVKkEAKVQ 358 Haemophilus ...
WP_018356248    286 -----------vERTVGNVRETVKHEAVK-----PVTQERKIVEKPTVKPAQTKTETARKAPv--QETKAAAKN-ERKVQ 346 Rodentibacte...
WP_005698092    282 -----------vQPTVEKHTATVEHKTEPRREQTPVVQEKKQPKPVTEKVTVQPTQTVKKESskiQEAKPVATK-DSKVQ 349 Haemophilus ...
WP_005704332    280 ------------SVEPSKPQEVVKP---QETVKKSEPVKAEKAKTEKTLKTENAAKAQQGKK---QQSKEQQAKtEKQVV 341 Aggregatibac...
WP_005722584    240 ------------ADKPS-----AVEKVTNEKVVTEKPKTVEKPK---------VVEKAKVPE---KPTHIEKAKvEKKVA 290 Pasteurella ...
WP_005758701    300 ------------AIEKVKPQEQVKTKSVEKAKTVEVTKVKPTEK--TKVVEQVKAKPAEKPQ---NSATNKPMVtEAKPA 362 Pasteurella ...
WP_005548305    288 ------------PSEPAKAQEAVKPRQHQESVKK-EPVKTDKVK---------QAEKATAKN---QPTKS--AKtEKEVR 340 Aggregatibac...
WP_005558815    289 ------------TTEPVKAPEAVKPRQHQETAKKAEPAKSDKVK---------QAEKATAKN---QPTKS--AKtEKEVR 342 Aggregatibac...
WP_014064225    356 -IVEAKSATHnamkaaepaaqTASTGATKTLTVPQGVSLMQVFRDNKLNISDVNAMTKASGAGNALSSFKPGDKVQVSVN 434 Haemophilus ...
1_ncbifamImport 327 -IVDAKPVSKs----------TASRLSAKTLTVPKGVSLMQLFRDNQLNISDVNAMSKATGAGNVLSSFKSGDKVTVSVN 395
WP_005632065    354 -IVDAKPATKv----------AAPTASAKTLTVPKGVSLMQVFRDNQLNISDVNAMSKAAGAGNVLSSFKPGDKVAISVN 422 Haemophilus ...
WP_005627046    359 -IVDAKPATKs----------AAPTTSAKTLTVPKGVSLMQVFRDNQLNISDVNAMSKAAGTGNVLSSFKPGDKVAVSVN 427 Haemophilus ...
WP_018356248    347 -VVEAKSAVNta--------kVVSSGASKTLTVPKGVSLMQVFRDNNLNISDVNAMTKANGAGNALSSFKPGDKVQVSLN 417 Rodentibacte...
WP_005698092    350 -IVDAKSASNnavkateptvqIASTGATKTLTVPQGVSLMQVFRDNKLNISDVNAMTKANGAGNALSSFKPGDKVQVSVN 428 Haemophilus ...
WP_005704332    342 dILEGRSSGS-----------KPAPTGSKTLTVPQGVTLMQVFRDNKLPIADVNAMTKAHGAGNALSRFKPGDKVQVSLN 410 Aggregatibac...
WP_005722584    291 pVVDAN---------------PAKASNSKTLTIPQGVSLMQVFRNHNLNIADVNAMTKASGAGNALSNFKAGDKVQISVN 355 Pasteurella ...
WP_005758701    363 tTSSASTKIT-------------QSTSQKTLTIPQGTSLMQVFRDNNLNISDVNAMTKANGANGALSGFKPGDKVQVSLN 429 Pasteurella ...
WP_005548305    341 dILEGKTTTI-----------TKAAAGSKTLTIPQGVTLMQVFRDNHLPVGDVNAMTKAKGVGKVLSSFKPGDKVQVSLN 409 Aggregatibac...
WP_005558815    343 dILEGKTTTT-----------SKAAAGSKTLTIPQGVTLMQVFRDNRLPVGDVNAMTKAKGVGNALSSFKPGDKVQVSLN 411 Aggregatibac...
WP_014064225    435 SQGRVSELRLSNGGKFIRQADGSYQYKK 462 Haemophilus parainfluenzae
1_ncbifamImport 396 NQGRVNEMRLSNGARFVRQSDGSYQYKK 423
WP_005632065    423 SQGRVNEMRLSNGTRFVRQSDGSYEYKK 450 Haemophilus haemolyticus
WP_005627046    428 SQGRVNEMRLSNGTRFVRQSDGSYEYKK 455 Haemophilus haemolyticus
WP_018356248    418 GQGRVNELRLSNGAKFVRQADGSYQFKK 445 Rodentibacter pneumotropicus
WP_005698092    429 SQGRVSELRLSNGGKFIRQADGSYQYKK 456 Haemophilus parainfluenzae
WP_005704332    411 SQGRVSEMRLSNGSRFVRQSDGSYQFKK 438 Aggregatibacter aphrophilus
WP_005722584    356 SQGRVNELRLENGAKFIRQADGSYIYKK 383 Pasteurella multocida
WP_005758701    430 PQGRVSTMRLSNGATFTRQADGTYQYKK 457 Pasteurella bettyae
WP_005548305    410 AQGRVSELRLPNGARFTRQSDGSYQFKK 437 Aggregatibacter actinomycetemcomitans
WP_005558815    412 AQGRVSELRLANGARFTRQSDGSYQFKK 439 Aggregatibacter actinomycetemcomitans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap