Conserved Protein Domain Family
UPF0565

?
pfam10561: UPF0565 
Uncharacterized protein family UPF0565
This family of proteins has no known function.
Statistics
?
PSSM-Id: 431359
Aligned: 17 rows
Threshold Bit Score: 308.534
Threshold Setting Gi: 74873322
Created: 27-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001998976  21 RIFSVAGFQ-NRANDIVYCPPIV-------------RQQSQHVDDSKAIIYFGGDVQDFPE-------SMETNRDSRGYM 79  Drosophila moja...
XP_005989576  46 KLPAVVGSEsGRANDLLLVLPTAacprdlretdrapPLQQQQQQQQHHVIYFPGDVQSYHD-------VMAYHSENFRWQ 118 coelacanth
OCA23210      38 RLPAVPGCEaTKCNDVVLRPA------------------RESSQKPQHVVYFPGDVQNYRD-------VMASHPENFRWK 92  tropical clawed...
XP_001614480   6 SVHNLAGYN-ERCNTVLYREPIR----------------TNKSYASKYIIFFPGDYSNFFTnsiytsfKLEATNECSDYC 68  malaria parasit...
O97301         6 STFKICGYN-EKYNTILYREPIL----------------TSEEYVKKYVIFFPGDYSYFFSnsvytsfKTQSTCECTNYC 68  Plasmodium falc...
OWR43671       5 RLRRVSGYE-GRVNDVIFRPAI-----------------SDAARGAETLVFFGGDVQDYPE-------AMQAHRDNRHYV 59  Danaus plexippu...
3_pfamImport   1 RINSVKGYQ-NRTNSIIYCPPLL-------------RGNSPK-EKCSAIVYFGGDVQDIPE-------KMESNRDNKNYI 58 
XP_001990233  21 RIFSVAGFQ-NRANDIVYCPPIV-------------RQQSQHVDDSKAIIYFGGDVQDFPE-------SMETNRDSRGYM 79  Drosophila grim...
XP_002073548  21 RIFSVAGFQ-NRTNDIVYCPPIV-------------RQQSQHVEDSTAIIYFGGDVQDFPE-------SMETNRDSRGYM 79  Drosophila will...
XP_003226132  63 RLPEVPGAEpAKTNDVLLLLP---------------DDGPLKAPPQHHVVYFPGDVQNYHE-------IMICHPENFQWE 120 green anole
XP_001998976  80 KYNLENSAILLREAFPRSHIIVIRPVRMEFKTFSCFDNFVRGNNAGVPDH------------------------------ 129 Drosophila moja...
XP_005989576 119 RWSLENVAIMLSLRFPNSYIWIVKSSRMHLHKFSCFDNFVESNLFGTPEY------------------------------ 168 coelacanth
OCA23210      93 QWSLEDVADMLSQRFPYSYIWIIKSSRMHLHKFSCYDNFVESNMFGAPKH------------------------------ 142 tropical clawed...
XP_001614480  69 -YSYEALFWVLSSKYLYDHLVFIKPS-LFVNHFSSFSNFLNPSDVSLSGHghpvtvargtgh-------------vntgg 133 malaria parasit...
O97301        69 -YSYEALFWILSQRYLYDYILFIIPS-DFSNYFATFSNFLNPCDIPLDNNlyelnrenennydvlnmenkinkksvsfik 146 Plasmodium falc...
OWR43671      60 KWNLESTARMLGESFVDKHIVVVRPSRIEFKSFSCYDNFVPSNNAGVPDH------------------------------ 109 Danaus plexippu...
3_pfamImport  59 KWNLENTALLLRESFPQSHIVVVRPMRMEYSTFSCFDNFVRGNNAGIPDH------------------------------ 108
XP_001990233  80 KYNLENSAILLREAFPRSHIIVIRPVRMEFKTFSCFDNFVRGNNAGVPDH------------------------------ 129 Drosophila grim...
XP_002073548  80 KYNLENSAILLREAFPRSHIIVIRPVRMEFKTFSCFDNFVRGNNAGVPDH------------------------------ 129 Drosophila will...
XP_003226132 121 QWCLENIAAILGHRFPGSYIWVIKCSRMHLHKFSCYDNFVASNMFGAPEH------------------------------ 170 green anole
XP_001998976 130 ------TPMNHALQHLEKLLQN---LSQRLIS-IPENEILDQAA-------QAAAAAAAVAAaAAAAAMT---------- 182 Drosophila moja...
XP_005989576 169 ------STDFGAFKHLCALLTNackLAQNLLLsRRDVNRLNKAAdne--acNSNSVHTTNGCpPEED------------- 227 coelacanth
OCA23210     143 ------STELGAFKHLQSLLTNafsAAQSLLVsQNNKYSVDRDYdls--kmDICPTYTTNGCpEKDNIIh---------- 204 tropical clawed...
XP_001614480 134 tnpgdaVVPAKSVNHLLCLLLS---LDERLsgg----------------svGSGESGLNGDHtASVNGTP---------- 184 malaria parasit...
O97301       147 neyinsNIRAKSIKHLLCLLLS---LNNEVLHkDMLNEGNFHKIinnennyNDNNDNNNNDNsNNDNNNNyyyiccdkpl 223 Plasmodium falc...
OWR43671     110 ------TPTHHALLHLERLLKN---VSIRMKT-MSERELLdvlrdvspdssvegcrtavp-------------------- 159 Danaus plexippu...
3_pfamImport 109 ------TPMHYSLQHLEELLIN---LTKKLTKpILDQEFLHKLL-------SASSTKGyggdvpckqnnadilqsniydg 172
XP_001990233 130 ------TPMNHALQHLEKLLQN---LSQRLIS-IPENEILDQAA-------QAAAAAAAVAAaAAAAALT---------- 182 Drosophila grim...
XP_002073548 130 ------TPMNHALQHLEKLLQN---LSQRLIS-IPENEILDQAA-------QAAAAAAAVAAaAAAAALT---------- 182 Drosophila will...
XP_003226132 171 ------NADFGAFMHLHALLLNafkLAQNILLsQKSMHDFPKDTkpp--tcELPPVATTNGCpRGERERD---------- 232 green anole
XP_001998976 183 ---LSNAT-VNSESSSASVAAaaaaaaaaaaandssqemdidilqvqenvtvdadgavifpivsagstetstatnnggnv 258 Drosophila moja...
XP_005989576 228 ----GTCGhSEKPFCILGSADqy--------------------------------------------------------- 246 coelacanth
OCA23210     205 ---------STIYLGMPSLKDs---------------------------------------------------------- 217 tropical clawed...
XP_001614480 185 ---CGDSNgEGTHTSAHGRSDhtdgpp----------------------------------------------------- 208 malaria parasit...
O97301       224 inyLGNELkTEKNIYSKERKNnifmk------------------------------------------------------ 249 Plasmodium falc...
OWR43671         --------------------------------------------------------------------------------     Danaus plexippu...
3_pfamImport 173 gaa----------------------------------------------------------------------------- 175
XP_001990233 183 ---LSNAT-VNSDTGPSSaavndssqemdidilqvqenvtvdadgavifpiisagltatgtttnnttpaadtvnngnnkd 258 Drosophila grim...
XP_002073548 183 ---LSNATsVNTDSTSASLTAassqaandnsqemdidilqvqenvtvdadgavifpivsgssnrinnec----------- 248 Drosophila will...
XP_003226132 233 ---CEYFGySSLGFIEPSVVGg---------------------------------------------------------- 251 green anole
XP_001998976 259 nnsnnkdallnnhqesniqqqqqqlqqqqqllqqqqqqpqqtvvkaasapmnnvdhynnttnssndcaadrqpslptqpq 338 Drosophila moja...
XP_005989576     --------------------------------------------------------------------------------     coelacanth
OCA23210         --------------------------------------------------------------------------------     tropical clawed...
XP_001614480     --------------------------------------------------------------------------------     malaria parasit...
O97301           --------------------------------------------------------------------------------     Plasmodium falc...
OWR43671         --------------------------------------------------------------------------------     Danaus plexippu...
3_pfamImport 176 -------------------------------------------------------------------------------g 176
XP_001990233 259 attnshqe--------------------------lnnqlqqqiaakatvsapannvehynninssidcaalqsslqtqpl 312 Drosophila grim...
XP_002073548 249 --------------------------------------------------------asavpvlstlpaaaattaaaaava 272 Drosophila will...
XP_003226132     --------------------------------------------------------------------------------     green anole
XP_001998976 339 qprpatptsennplwwrenlnldkSKLVLIGFSKGCVVLNQFIYEFHYLKTltpdDSSMCRLLSRITDMYWLDGGHGGQK 418 Drosophila moja...
XP_005989576 247 ----------------------ssVSFTLIGFSKGCVVLNQLLHELKVAKN----NKELATFIKNIKAMYWLDGGHSGGN 300 coelacanth
OCA23210     218 ------------------------LSITVIGFSKGCVVLNQLLYELQEAIK----DKDIQSFLANIKAMYWLDGGHSGGC 269 tropical clawed...
XP_001614480 209 ------------------plsplkRRLVLIGFSRGCSVLFALMREANEGQL----------LLPYVDSVYLLDPGFNKRL 260 malaria parasit...
O97301       250 --------------------niikNKLVLIGFSKGCSVLFSLLRESHEGPF----------FWSYVDSIIFLDPGFNKNI 299 Plasmodium falc...
OWR43671     160 ----repssardplwwreslaldeSSISLVGFSKGCVVLNQIIYEFHYTQTltpgDEHMMRLSGRICDMYWLDGGHAGGK 235 Danaus plexippu...
3_pfamImport 177 aedpaepddlaellwwrenlnldkASLKLIGFSKGCVVLNQFIYEFHYYKTltpdDSTMMRLVSRISDMYWLDGGHGGGK 256
XP_001990233 313 qprpttptsennplwwrenlnldkSKLVLIGFSKGCVVLNQFIYEFHYLKTltpdDSSMCRLLSRITDMYWLDGGHGGQK 392 Drosophila grim...
XP_002073548 273 aqtprqatsdsnplwwrenlnldkSKLVLIGFSKGCVVLNQFIYEFHYLKTltpdDSSMCRLLSRITDMYWLDGGHGGQK 352 Drosophila will...
XP_003226132 252 ------------------------ASFTLIGFSKGCVVLNQLLHELKEAEK----DKDICAFIKNIKAIYWLDGGHSGGS 303 green anole
XP_001998976 419 NTWITSRSLLETLTRMGMNIHVHLTPYQVQDDRRPWIRKEEKLFTEMLRRLNAP 472 Drosophila mojavensis
XP_005989576 301 DTWVTSQEVLRELAQLEVAVYTHVTPYQVHDTMRSWIGKEHRKFVRILRDFNME 354 coelacanth
OCA23210     270 DTWITNPEILKAFALTGIAVHTHVTPYQVRDIMRSWIGEEHRKFVQLLKKYNVK 323 tropical clawed frog
XP_001614480 261 YNTEIESSALEKVAQCGLKIFLHSTPHQVTNKNDVHIHSELLNFLKKLRQHGVG 314 malaria parasite P. vivax
O97301       300 YNINIEKNALEKLSQHKLKISVHCTPNQIMDNTSMNIHEEYIHFVKILKDIHIY 353 Plasmodium falciparum 3D7
OWR43671     236 NTWLTARSLLETIATRGVNIYIHVSPYQIKDESRPWIGREEKIFSSLLKKLGAK 289 Danaus plexippus plexippus
3_pfamImport 257 NTWITSRSLLETLCRLCINVHVHVTPYQIQDDHRPWIRKEEKAFTDLLKRLGAA 310
XP_001990233 393 NTWITSRSLLETLTRMGMNIHVHLTPYQVQDDRRPWIRKEEKLFTEMLRRLNAP 446 Drosophila grimshawi
XP_002073548 353 NTWITSRSLLETLTRMGMNIHVHLTPYQVQDDRRPWIRKEEKLFTEMLRRLNAP 406 Drosophila willistoni
XP_003226132 304 NTWVTYPDVLKDFAQTGISVNAHVTPYQVFDTMRAWIGKEHKKFVQILHELGVN 357 green anole
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap