Conserved Protein Domain Family
Innate_immun

?
pfam12782: Innate_immun 
Invertebrate innate immunity transcript family
The immune response of the purple sea urchin appears to be more complex than previously believed in that it uses immune-related gene families homologous to vertebrate Toll-like and NOD/NALP-like receptor families as well as C-type lectins and a rudimentary complement system. In addition, the species also produces this unusual family of mRNAs, also known as 185/333, which is strongly upregulated in response to pathogen challenge.
Statistics
?
PSSM-Id: 432781
Aligned: 2 rows
Threshold Bit Score: 412.24
Threshold Setting Gi: 118421402
Created: 27-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ABK88364       1 MEVKVTLIVAIVAALAISAHAQRDFNERRGKENDTERGQGGFGGRPGGMQMGSPRQDGGQMGGRRFDGPESGAPQMEGRR 80  purple sea urchin
1_pfamImport   1 MEVKVTLIVAIVAALAISAHAQRDFNERRGKENDTERGQGGFGGRPGGMQMGSPRQDGGQMGGRRFDGPESGAPQMEGRR 80 
ABK88364      81 QNGGPMGGRRFDGPRFGGSRPDGAGGRPFFGQGGRRGDGEEETDAAQQIGDGLGGRGQFDGHGRGHHGHRQGPPQDRPEE 160 purple sea urchin
1_pfamImport  81 QNGGPMGGRRFDGPRFGGSRPDGAGGRPFFGQGGRRGDGEEETDAAQQIGDGLGGRGQFDGHGRGHHGHRQGPPQDRPEE 160
ABK88364     161 QPFGQRNESSDEDGRPHPRHHGRHHQHHHRNHTEGHQGHNETGDHPHRHHNKTGDGDQDRPMFEMRPFRFNPFGRKPFGD 240 purple sea urchin
1_pfamImport 161 QPFGQRNESSDEDGRPHPRHHGRHHQHHHRNHTEGHQGHNETGDHPHRHHNKTGDGDQDRPMFEMRPFRFNPFGRKPFGD 240
ABK88364     241 RPFGRRNGTEEGSPRRDGQRRPYGNRGRWGENESEEKEHPTTESVTTSSPP 291 purple sea urchin
1_pfamImport 241 RPFGRRNGTEEGSPRRDGQRRPYGNRGRWGENESEEKEHPTTESVTTSSPP 291
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap