Conserved Protein Domain Family
Bromo_AAA

?
cd05528: Bromo_AAA 
Bromodomain; sub-family co-occurring with AAA domains. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. The structure(2DKW) in this alignment is an uncharacterized protein predicted from analysis of cDNA clones from human fetal liver
Statistics
?
PSSM-Id: 99957
View PSSM: cd05528
Aligned: 11 rows
Threshold Bit Score: 158.675
Threshold Setting Gi: 66810249
Created: 13-Sep-2006
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                    #    #  #                                      #   # 
NP_563753     895 LRRLRMCLRDVCNRILYDKRFSAFHFPVTDEDAPNYRSIIQIPMDTATLLQRVDTGQYLTCTPFLQDVDLIVRNAKAYNG 974  thale cress
BAD18469      428 LRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNP 507  human
AAN41251      881 VRRMRMCLRDICNRILYNKRFNVFHFPVLEDEVPDYRSIIHKPMDMATVLQRVDSGQYLTRAAFIKDIDLIVSNAKTYNG 960  Zea mays
CAG12863      842 LRELRLFLRDVTNRLSQDKRFKAFTKPVDLAEVPDYADVIKKPMDLSTVLSKIDLHRYGTVKEFLQDVDLIWQNALEYNP 921  Tetraodon nig...
XP_640671    1290 VRQLRILLREMVSKIIFDKKYLSFFRDVNAEQFPEYYELIKNPMSLQRISQNLDSYEYISLESFLKDIDLIVTNTELYYH 1369 Dictyostelium...
XP_001603905  683 LRELRIFLREICAKLARNRQFFMFTKPVDIEEVPDYNEIIEQPMDLETMMTKIDMHCYLCARDFLDDIDLICRNALEYNP 762  jewel wasp
XP_790486     971 LRELRIFLRDVLTRLASERKFRVFTSPVDPEEVPDYVEVIKQPMDLFTMNNKINLHQYTSAKQFLGDIDLITSNALEYNP 1050 purple urchin
CAO82044      914 QRQMRLFFKERLTRLMRDRRFVEFVEPVDPDEAEDYYEIIETPICMQDIMEKLNNCEYNHADKFVADLILIQTNALEYNP 993  nematode
XP_638848     992 ILNDYYFLRMVLKSLESIEQLRPFYVPVLEEEAPSYFLIIKQPMSFQQIKQSLNTYAYENTDDFWKDITLIYTNAQLFNC 1071 Dictyostelium...
XP_419982     762 LRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLTDIDLICSNALEYNP 841  chicken
CAG01478      542 LRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIRQPMDLSTVVARIDTHQYLTAKDFLLDIDLICNNALEYNP 621  Tetraodon nig...
Feature 1                                                     #                       
NP_563753     975 Ddy-------------------------------------agARIVSRAYELRDVVHGMLSQMDPALL 1005 thale cress
BAD18469      508 Dkdp------------------------------------gdKIIRHRACTLKDTAHAIIAAELDPEF 539  human
AAN41251      961 Ddy-------------------------------------ngSRIVSRACELRDVVQGMLSQMDPSLV 991  Zea mays
CAG12863      922 DrdpsgthtvassntgdegtgtlvgwfglvwfvshscvlgldRQIRHRACALKDTVHAIIRSELDEDF 989  Tetraodon nigroviridis
XP_640671    1370 Fndsn---------------------------------sleaIKANSRSKQLQDEVLSMVENIDPTLI 1404 Dictyostelium discoideum AX4
XP_001603905  763 Drdp------------------------------------adKLIRHRACSLRDNAYALIKAELDSDF 794  jewel wasp
XP_790486    1051 Drqp------------------------------------sdRMIRNRACELKDMAYAIIDAEMDSDF 1082 purple urchin
CAO82044      994 Sttk------------------------------------dgKLIRQMANTLRDAIDDLIECELDESF 1025 nematode
XP_638848    1072 S-----------------------------------------KTSVYKASRLLQEIANKLESDCPPKV 1098 Dictyostelium discoideum AX4
XP_419982     842 Dkdp------------------------------------gdKIIRHRACTLKDTAHAIIAAELDPEF 873  chicken
CAG01478      622 Dkdp------------------------------------gdKVIRHRACSLKDTAHAIFAAELDPEF 653  Tetraodon nigroviridis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap