Conserved Protein Domain Family
FkpA

?
COG0545: FkpA 
FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 223619
Aligned: 45 rows
Threshold Bit Score: 161.044
Threshold Setting Gi: 1169688
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1723247  148 SdeeEMDDISVTSSEEEEEENGARIEELNSDEEDaeqAEEEILEKPVPKDEVaekhSKDKLKKEEKEKKTAVDVSDSVNG 227 fission yeast
15834439  51 GntmTTPTFDTIEAQASYGIGLQVGQQLSESGLEg--LLPEALVAGIADALE----GKHPAVPVDVVHRALREIHERADA 124 Escherichia coli O1...
15598912     --------------------------------------------------------------------------------     Pseudomonas aerugin...
15599768   1 ---mSELNLTTDEARVSYGIGRQLGDQLRENPVPg--MTLDAVLAGLSDAFA----GIDSRVSGEALSASFQVIRERMQA 71  Pseudomonas aerugin...
15603763   3 QqffDQVSLESLSAKGSYGIGLQIGQQLLESQLE---VSAEAVAKGIFDVLN----QNPPALELNEVSHALQTLQQQATE 75  Pasteurella multocida
16767643  12 GkimATPTFDTIEAQASYGIGLQVGQQLSESGLEg--LLPEALVAGIADALE----GKHPAVPVDVVHRALREIHERADA 85  Salmonella typhimur...
15642563   1 MtfmSEVKFETVEQKASYGIGLQMGQQLAGSGLEg--LNVAAIAAGIATALV----GEQPAISIDEINQALHAIHMRAEE 74  Vibrio cholerae
16123678   1 ---mTTPSFDSVEAQASYGIGLQIGQQLQESGLQg--LLPEALLAGLRDAME----GNTPTVPVDVIHRALQEVHEKADK 71  Yersinia pestis
15804798  51 GntmTTPTFDTIEAQASYGIGLQVGQQLSESGLEg--LLPEALVAGIADALE----GKHPAVPVDVVHRALREIHERADA 124 Escherichia coli O1...
16132029  51 GntmTTPTFDTIEAQASYGIGLQVGQQLSESGLEg--LLPEALVAGIADALE----GKHPAVPVDVVHRALREIHERADA 124 Escherichia coli K12
1723247  228 KKRKTEPAGEGEQTEKKSKSTKTYPKQVLEGNVTVQDKVKGDGPAAKRKKRVSMRYIGRLTNGKVFDKN-ITGKPFTFNL 306 fission yeast
15834439 125 VRRQRFQAMAAEGVKYLEENAKKEGVNSTESGLQFRVINQGEGAIPARTDRVRVHYTGKLIDGTVFDSSvARGEPAEFPV 204 Escherichia coli O1...
15598912   1 ----------------------------MNDRLQIEDLLLGDGKEVVKGALITTQYKGTLEDGTLFDSSyERGRPFQCVI 52  Pseudomonas aerugin...
15599768  72 EAQAKAEAAAGEGRAYLAENAKREGVTVLPSGLQFEVLSTGEGAKPSREDTVRTHYHGTLIDGTVFDSSyQRGQPAEFPV 151 Pseudomonas aerugin...
15603763  76 AQQAKFKEIEAVGAQFLAENAQKAGVNTTESGLQYEVLVAGEGQIPAREDKVRVHYTGTLIDGTVFDSSvKRGQPAEFPV 155 Pasteurella multocida
16767643  86 VRRERFKAMAAEGVKYLEENREKDGVNSTESGLQFRVLTQGEGAIPARTDRVRVHYTGKLIDGTVFDSSvARGEPAEFPV 165 Salmonella typhimur...
15642563  75 ARQEAAKVAASEGEAFLKDNALRPEVTVLESGLQYEVLVEGNGAIPTSDKSVRVHYHGQLVDGTVFDSSvSRGQPAEFPV 154 Vibrio cholerae
16123678  72 VRIERQQALVDEGKTFLEENAKRDDVTTTESGLQFSVLQAGDGPIPSRQDRVRVHYTGRLVDGTVFDSSvERGQPADFPV 151 Yersinia pestis
15804798 125 VRRQRFQAMAAEGVKYLEENAKKEGVNSTESGLQFRVINQGEGAIPARTDRVRVHYTGKLIDGTVFDSSvARGEPAEFPV 204 Escherichia coli O1...
16132029 125 VRRQRFQAMAAEGVKYLEENAKKEGVNSTESGLQFRVINQGEGAIPARTDRVRVHYTGKLIDGTVFDSSvARGEPAEFPV 204 Escherichia coli K12
1723247  307 GleEVIKGWDVGIVGMQVGGERTIHIPAAMAYGSKRLPG--IPANSDLVFDVKLLAVN 362 fission yeast
15834439 205 N--GVIPGWIEALTLMPVGSKWELTIPQELAYGERG-AGasIPPFSTLVFEVELLEIL 259 Escherichia coli O157:H7
15598912  53 GtgRVIKGWDQGLMGMKVGGKRRLFVPSHLAYGERQVGAh-IKPHSNLLFEIELLEVL 109 Pseudomonas aeruginosa PA01
15599768 152 G--GVIAGWVEALQLMNAGSKWRLHVPSELAYGGQA-VGs-IPPHSVLVFDVELLEIL 205 Pseudomonas aeruginosa PA01
15603763 156 N--GVIAGWIEALSMMPVGSKWRLTIPHNLAYGERG-AGasIPPFSTLVFEVELLAIL 210 Pasteurella multocida
16767643 166 N--GVIAGWIEALTLMPVGSKWELTIPQELAYGERG-AGasIPPFSTLVFEVELLEIL 220 Salmonella typhimurium LT2
15642563 155 T--GVIRGWVEALQLMPVGSKWKLYIPHNLAYGERG-AGaaIPPFAALVFEVELLDIL 209 Vibrio cholerae
16123678 152 S--GVIPGWIEALSMMPVGSKWKLYIPHNLAYGERG-AGatIPPFSALMFEVELLEIL 206 Yersinia pestis
15804798 205 N--GVIPGWIEALTLMPVGSKWELTIPQELAYGERG-AGasIXPFSTLVFEVELLEIL 259 Escherichia coli O157:H7 EDL933
16132029 205 N--GVIPGWIEALTLMPVGSKWELTIPQELAYGERG-AGasIPPFSTLVFEVELLEIL 259 Escherichia coli K12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap