1FPW


Conserved Protein Domain Family
FRQ1

?
COG5126: FRQ1 
Click on image for an interactive view with Cn3D
Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms]
linked to 3D-structure
Statistics
?
PSSM-Id: 227455
Aligned: 19 rows
Threshold Bit Score: 127.04
Threshold Setting Gi: 19074158
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FPW_A     4 KTSKLSKddl----tcLKQSTYFDRREIQQWHKGFLRDCP--SGQLAREDFVKIYKqFFPFGSPEDFANHLFTVFDKd-- 75  baker's yeast
19173114   1 MRRRQRRq-------sSNIFHMLTKNQIVELREAFNFMDVnsDTFVDRGDLENFLA-SIGSPFSESEIDEMMAEGG---- 68  Encephalitozoon cun...
19074158   4 GASTIPDnve----edVRQFSHFPPRDIQEWSSSFRSEYP--GGCMTLKDLEAMFRsFFPFGSPTNFSRRLFETINIs-- 75  Encephalitozoon cun...
19173343   1 MGSLSSTmlceeeieeLKNTTVFDEREIEHLYERFQFLDResRGYLTYNELNNIP--EFQSNPFSHLIMKSIEKMTD--- 75  Encephalitozoon cun...
1171671    4 SQSKLSQdql----qdLVRSTRFDKKELQQWYKGFFKDCP--SGHLNKSEFQKIYKqFFPFGDPSAFAEYVFNVFDAd-- 75  fission yeast
15214080  20 TTSSQRVaaqaakrasSGAFAQLTSSQIQELKEAFALLDKdgDGNIGREDVKTMLT-SLNQDASEDSINHMFESIN---- 94  fission yeast
12229767   4 SQSQIFEd--------LISNSSFSNEEIERIRKRFIKIDAnqSGSIDRNEFLSI-----PSVASNPLASRLFSVVDEd-- 68  fission yeast
1723899    1 ------------------------MSATRANKDIFTLFDKkgQGAIAKDSLGDYLR-AIGYNPTNQLVQDIINADSSl-- 53  baker's yeast
115495     4 APSKIVDg--------LLEDTNFDRDEIERLRKRFMKLDRdsSGSIDKNEFMSI-----PGVSSNPLAGRIMEVFDAd-- 68  baker's yeast
20138586   1 -----------mdhseSLTFNQLTQDYINKLKDAFQMLDEdeDGLISRGDLTKIYA-TLGKTLTDEEWSKMVPDNDTsta 68  baker's yeast
1FPW_A    76 --NNGFIHFEEFITVLSTTS------RGTLEEKLSWAFELYDLNHDGYITFDEMLTIVAsvykmmgsmvtlNEDEATPEM 147 baker's yeast
19173114  69 ----DSMTYMLFLTMIGERLs-----CTDSEKSIFNALKEFDDNGDGTIDEKVLREWLT------------EKGDRMADE 127 Encephalitozoon cun...
19074158  76 --QTETVDFHELLIAYSILVk-----GSD-HEKLRWMFRFYDKDNDGVVSKEEMVEVVQclad----mtshTLDISIDAE 143 Encephalitozoon cun...
19173343  76 ---YEKMTFPHFLEFLGIFSe-----RNSKRNRIRYLFDIFDLNGDGRLCRNVLIRINK------------MMGQDGRVE 135 Encephalitozoon cun...
1171671   76 --KNGYIDFKEFICALSVTS------RGELNDKLIWAFQLYDLDNNGLISYDEMLRIVDaiykmvgsmvklPEDEDTPEK 147 fission yeast
15214080  95 ----PPINLAAFLTAMGSMLc-----RISPRNDLLEAFSTFDDTQSGKIPISTMRDALS------------SMGDRMDPQ 153 fission yeast
12229767  69 --GGGDVDFQEFINSLSVFSv-----HGNKEEKLKFAFKIYDIDRDGYISNGELYLVLKmmv-------gtNLREDQLQQ 134 fission yeast
1723899   54 -rDASSLTLDQITGLIEVNEkeldatTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLT------------GLGEKLTDA 120 baker's yeast
115495    69 --NSGDVDFQEFITGLSIFSg-----RGSKDEKLRFAFKIYDIDKDGFISNGELFIVLKimv-------gsNLDDEQLQQ 134 baker's yeast
20138586  69 evGEEGVSFPIFLSIMGKNLs-----QFPEREELEESLKAIGRGHDLNVPLNEVIDSLK------------EAGFENPEE 131 baker's yeast
1FPW_A   148 RVKKIFKLMDKNEDGYITLDEFREGSKVDPSI 179 baker's yeast
19173114 128 DVNLLLRDCVE--NGRIDCRSLTTKMKYGEII 157 Encephalitozoon cuniculi
19074158 144 GIVSEIFASVESDRGFLTFEDFKTLSIRSEKL 175 Encephalitozoon cuniculi
19173343 136 EAENLLNIYDEGGKGYLDISDFTRFYESDPLI 167 Encephalitozoon cuniculi
1171671  148 RVNKIFNMMDKNKDGQLTLEEFCEGSKRDPTI 179 fission yeast
15214080 154 EVESILRSYT--SHGVFYYEKFVDAIAGSKDS 183 fission yeast
12229767 135 IVDKTIMEVDKDRDGKISFEEFKD--IVSGSN 164 fission yeast
1723899  121 EVDELLKGVEVDSNGEIDYKKFIEDVLRQ--- 149 baker's yeast
115495   135 IVDRTIVENDSDGDGRLSFEEFKN--AIETTE 164 baker's yeast
20138586 132 EFAKLFKLFTTNQQATEERTFRGKLFLDSITD 163 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap